Supercharge Your Innovation With Domain-Expert AI Agents!

Application of Cucumber 6-Phosphogluconolactonase cspmr1 in Resistance to Cucurbit Blight

A technology of phosphoglucose and acid lactone, applied in the field of plant molecular biology and plant genetic engineering, to achieve the effect of improving resistance and wide application prospects

Active Publication Date: 2021-06-01
INST OF VEGETABLES GUANGDONG PROV ACAD OF AGRI SCI
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Previous studies on 6-phosphogluconolactonase participating in plant disease resistance have not been reported, and there is only one report on 6-phosphogluconolactonase participating in wheat cold resistance

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of Cucumber 6-Phosphogluconolactonase cspmr1 in Resistance to Cucurbit Blight
  • Application of Cucumber 6-Phosphogluconolactonase cspmr1 in Resistance to Cucurbit Blight
  • Application of Cucumber 6-Phosphogluconolactonase cspmr1 in Resistance to Cucurbit Blight

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0041] Example 1 Construction of Cucumber CsPS1 Gene Overexpression Vector

[0042] The protein encoded by the cucumber CsPmR1 gene is 6-phosphogluconolactonase, which can catalyze the hydrolysis of 6-phosphogluconolactone into 6-phosphogluconic acid. The full-length construction of the cucumber CsPmR1 gene CDS into pGWB5 (its map is attached figure 1 As shown), an overexpression vector was obtained; the cucumber gene CDS non-conserved segment about 200bp in length and its complementary fragment were constructed into pK7GWIW (its map is attached figure 2 Indicated), the gene silencing vector was obtained.

[0043] The amino acid sequence of cucumber 6-phosphogluconolactonase CsPmR1 is (240aa):

[0044]MAQTEKRVFDSEEDLAVSLAKYIAHLSDQFAKNKGLFTVVLSGGSLIECLRKLVEPPYVDSIDWSIWHIFWLDESAVPKTHVDSNYKLAYDGFLSKVPIPLGNVYAIDDTLSAEGAAEEYEARLKHLVNSKVIDISAKSGFPKFDLNLLGMGPDAHVASLFPGHPLLKENKKWVTFIKDSPKPPPERITLTFPVINSSDYIALVVPGDAQADAVSIALGGGNPPTADETLPVQRVALKVF(SEQ ID NO.1)。

[0045] Cucumber 6-p...

Embodiment 2

[0051] Example 2 Constructing a Cucumber Cotyledon Model of Transient Overexpression / Gene Silencing

[0052] (1) The overexpression vector and the silencing vector in Example 1 were respectively transformed into Agrobacterium GV3101, and cultured upside down on the corresponding resistant medium for 48-72 hours.

[0053] (2) Pick a single clone and add it to 4 mL of LB medium containing the corresponding antibiotics and rifampicin, shake the bacteria at 180 rpm for 24-36 hours at 28°C.

[0054] (3) Add fresh LB medium containing corresponding antibiotics and rifampicin at a ratio of 1:100, shake the bacteria at 28°C and 180 rpm until the OD600 value is about 3.0.

[0055] (4) Centrifuge at 3000rpm for 5 minutes to collect the bacteria, and use the suspension (10mM MES, 10mM MgCl 2 ) to resuspend the cells, adjust the OD600 value to about 0.4, and add 200 mM acetosyringone.

[0056] (5) Stand at room temperature for 3-5 hours.

[0057] (6) Prick a needle hole on both sides o...

Embodiment 3

[0070] Example 3 Cucumber cotyledon disease resistance experiment

[0071] For the cucumber cotyledon model with transient overexpression of CsPmR1 successfully constructed in Example 2, the cucumber cotyledon model of CsPmR1 gene silencing, and the wild-type cucumber cotyledon, the cucumber seedlings after injection were cultured in the dark for 12 hours and then cultured in the light at 22°C for 3 to 4 days. Cucumber cotyledons were isolated and inoculated with Phytophthora cucurbiti, and cultured in a culture dish at 28°C for 24 hours in the dark.

[0072] The resistance function of the target gene to the disease was judged according to the size of the lesions on the isolated cucumber cotyledons of different treatments. The results are shown in the attached Figure 5 shown.

[0073] The results showed that transient overexpression of CsPmR1 gene in cucumber cotyledon can significantly enhance the resistance of cucumber cotyledon to blight compared with the control, while tra...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention firstly discloses the application of 6-phosphogluconolactonase CsPmR1 in resisting melon blight. In particular, CsPmR1 has a disease resistance function against Phytophthora melonis which infects melons. Overexpression of CsPmR1 gene can significantly enhance the resistance of cucumber and pumpkin cotyledon to blight compared with control, while transient silencing of CsPmR1 gene in cucumber cotyledon can significantly weaken the resistance of cucumber cotyledon to blight compared with control. The CsPmR1 gene plays a very important role in the resistance of melons such as cucumbers and pumpkins to diseases, and has broad application prospects.

Description

technical field [0001] The invention relates to the fields of plant molecular biology and plant genetic engineering, and more specifically, relates to the application of cucumber 6-phosphogluconolactonase CsPmR1 in resisting melon blight. Background technique [0002] Melon blight is a worldwide oomycete disease. The pathogen is Phytophthora melonis, which causes the leaves, stems, and fruits of cucumbers, pumpkins, wax gourds, and bitter melons to turn brown and cause death or dead seedlings. The disease has occurred in areas where melons are planted in my country, and it occurs more frequently in summer and autumn open field cultivation and spring protected melons in the north; in the south, it occurs more frequently in spring and summer and autumn high temperature and humidity seasons. The entire growth period and various parts of melons can be damaged. The damaged growth point of the seedlings and the base of the tender stems are water-soaked and constricted, wilting and...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/82C12N9/18A01H5/00A01H6/34A01N63/50A01N63/60A01N63/40A01N37/46A01N57/16A01P3/00
CPCA01N37/46A01N57/16A01N63/40A01N63/50A01N63/60C12N9/18C12N15/8282C12Y301/01031
Inventor 王瑞吴廷全杜虎徐晓美金庆敏杨晓珊
Owner INST OF VEGETABLES GUANGDONG PROV ACAD OF AGRI SCI
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com