Sclerostin and application thereof in preparation of related products for treating or preventing Alzheimer's disease
A technology for Alzheimer's disease and sclerostin, applied in the field of biomedicine, can solve problems such as degrading protease dysfunction, aggravating cognitive function, losing binding and stabilizing microtubules, etc., to inhibit the production of Aβ protein and accelerate The production of Aβ protein and the effect of alleviating Alzheimer's disease
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] Embodiment 1 Sclerostin preparation
[0030] The amino acid sequence of mouse sclerostin (sclerostin) with chemical synthesis purity greater than 98% is shown in SEQNO.1:
[0031] MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLLTFHNQSELKDFGPETARPQKGRANKPRAPGARGAK
[0032]The synthesized sclerostin powder was dissolved in double-distilled water to prepare a solution with a concentration of 1 μg / μl, and stored at -80°C for future use after aliquoting. When in use, it is diluted with double distilled water to a corresponding concentration and stored for later use. In this embodiment, it is diluted to 200 ng / ml.
Embodiment 2
[0033] Example 2 Construction of sclerostin neutralizing antibody based on sclerostin recombinant protein
[0034] According to the amino acid sequence of mouse sclerostin, a neutralizing antibody that can penetrate into the mouse body was constructed. The specific construction method is as follows:
[0035] Material preparation stage: Immunogen verification
[0036] Immunogen preparation: the mouse sclerostin constructed according to Example 1 was used as an immunogen, and the protein antigen was detected by SDS-PAGE. Responsible for coupling it with Immunoplus as an immunogen to break the immune tolerance of mice.
[0037] Quality control (QC): polyacrylamide gel electrophoresis (SDS-PAGE) method, purity>75%.
[0038] Phase 1: Animals immunized with SC2033-PF
[0039] A conventional immunization scheme was used to immunize 3 BALB / C mice + 3 C57 mice with the target protein-Immunoplus;
[0040] The routine immunization schedule is shown in the table below.
[0041]
...
Embodiment 3
[0063] According to the amino acid sequence of sclerostin, the sost overexpression plasmid was constructed and combined with the relatively mature bone-targeting virus AAV9-DSS-Nlter (standard reference: Yang, Y.S., et al. (2019)."Bone -targeting AAV-mediated silencing of Schnurri-3 prevents bone loss inosteoporosis." Nat Commun 10(1):2958.), construct a bone-targeting overexpression sost virus, which is used to inject into mice for related experimental verification.
[0064] Obtain the target gene by PCR or enzyme digestion, construct the target vector by ligation or homologous recombination / assembly, and transform E.coli DH5α competent cells. Transformants were screened by colony PCR, and positive clones were sent for sequencing. The verified clones were subjected to plasmid extraction. In this embodiment, PCR is used for construction.
[0065] Query the target gene and the upstream and downstream sequences from GenBank, and use VectorNTI software to design primers. The se...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


