Antimicrobial peptide AP-57 as well as preparation method and application method thereof

An AP-57, application method technology, applied in the fields of biochemistry and biomedicine, can solve the problems of few types of human antimicrobial peptides, difficult production and quality control, and small number of amino acids, and achieves significant antibacterial and antifungal, obvious antibacterial and antifungal properties. Anti-enveloped virus and mycoplasma, the effect of large development potential

Active Publication Date: 2015-03-04
SICHUAN UNIV
View PDF0 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0018] The purpose of the embodiments of the present invention is to provide an antimicrobial peptide AP-57 and its preparation method and application method, aiming at solving the problem that there are relatively few types of human antimicrobial peptides in the existing technology, and the solid-phase synthesis of peptides is suitable for the number of amino acids. For target polypeptides with fewer and fewer disulfide bonds, production and quality control are more difficult for proteins with more amino acid numbers and more disulfide bonds, and the production cost is relatively high

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antimicrobial peptide AP-57 as well as preparation method and application method thereof
  • Antimicrobial peptide AP-57 as well as preparation method and application method thereof
  • Antimicrobial peptide AP-57 as well as preparation method and application method thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0043] In order to make the object, technical solution and advantages of the present invention more clear, the present invention will be further described in detail below in conjunction with the examples. It should be understood that the specific embodiments described here are only used to explain the present invention, not to limit the present invention.

[0044] The application principle of the present invention will be further described below in conjunction with the accompanying drawings and specific embodiments.

[0045] The antibacterial peptide AP-57 of the embodiment of the present invention is a polypeptide, corresponding to the mature protein sequence of the C10orf99 gene expression product after removing the signal peptide, containing 57 amino acids, and the sequence is:

[0046] KRRPAKAWSGRRTRLLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV;

[0047] Theoretical molecular weight (MW) is: 6.52D; theoretical isoelectric point (pI) is 11.28; it is a strong cationic amphip...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an antimicrobial peptide AP-57 as well as a preparation method and an application method thereof. The antimicrobial peptide AP-57 is a polypeptide and contains 57 amino acids. The preparation method comprises the following steps: optimizing the eukaryotic expression nucleotide sequence of the human AP-57 into the nucleotide sequence suitable for escherichia coli expression; transforming a recombinant expression plasmid to engineered escherichia coli BL21 competent cells; picking up a monoclonal antibody for enlarged cultivation and inducible expression; performing affinity chromatography; performing cation exchange chromatography; finally, performing mass spectrum identification. The antimicrobial peptide AP-57 has the functions of broad-spectrum antiviral microorganisms, is capable of resisting bacteria, fungi, viruses and mycoplasmas, and is a novel human antimicrobial peptide having a plurality of biological functions; the antimicrobial peptide AP-57 has remarkable antibacterial and antifungal effects and a prominent effect in resisting enveloped virus and mycoplasma, and thus has a great potential application value in the aspects of inhibiting the growth, breeding and spreading of microorganisms and preventing or treating pathogenic microorganism infection.

Description

technical field [0001] The invention belongs to the technical field of biochemistry and biomedicine, and in particular relates to an antimicrobial peptide AP-57 and its preparation method and application method. Background technique [0002] Microbial infections, including bacteria, fungi, viruses, etc., can cause many very serious human diseases including hepatitis, pneumonia, AIDS, tuberculosis, etc. Infectious epidemics caused by pathogenic microorganisms are always one of the important causes of human death. [0003] Since the invention of antibiotics, the lives of countless patients with bacterial infections have been saved. However, the use of a large number of antibiotics not only brings many side effects to patients, but also causes the breeding of a large number of drug-resistant strains. And antibiotics are often ineffective against viral infections. [0004] Antimicrobial peptides are a general term for short peptides with antibacterial activity. In 1975, Swed...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K14/47C12N15/70C07K1/22C07K1/18A61P31/04A61P31/10A61P31/12
CPCA61K38/00C07K14/47C12N15/70
Inventor仝爱平杨梅佳唐梅郭刚马先君杨丽佳周良学魏于全
OwnerSICHUAN UNIV