A High-Throughput Screening Method for Prey Antagonists Based on Membrane-Bound Proteins and Fluorescence Complementation

A receptor antagonist and prey technology, applied in the field of genetic engineering, can solve the problems of insufficient use of compound libraries, poor reproducibility, and difficulty in ensuring activity.

Active Publication Date: 2019-12-03
SHANGHAI JIAOTONG UNIV
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

This type of method needs to purify the active ligand protein, and needs to label the ligand protein. It is difficult to guarantee the activity and the reproducibility is not strong.
[0004] For the screening method of intracellular soluble receptor antagonists, a method based on the traditional yeast two-hybrid method has been proposed, but the receptors and ligands studied by the traditional yeast two-hybrid method exist inside the cell, and the compound must be able to enter the cell effectively. Opportunity for blocking, but this factor is difficult to control in high-throughput screening, so the entire compound library is not fully utilized

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A High-Throughput Screening Method for Prey Antagonists Based on Membrane-Bound Proteins and Fluorescence Complementation
  • A High-Throughput Screening Method for Prey Antagonists Based on Membrane-Bound Proteins and Fluorescence Complementation
  • A High-Throughput Screening Method for Prey Antagonists Based on Membrane-Bound Proteins and Fluorescence Complementation

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0072] Example 1. Vector construction and expression localization of CXCL12 ligand protein

[0073] Objective: To achieve the effect of localizing on the cell membrane by fused expression of CXCL12 gene with signal peptide gene and transmembrane peptide gene.

[0074] Plasmid construction: the mouse chemokine CXCL12 mature peptide coding sequence (shown in SEQ ID NO.5, specifically: KPVSLSYRC PCRFFESHIA RANVKHLKIL NTPNCALQIV ARLKNNNRQV CIDPKLKWIQ EYLEKALNK) was amplified and sequenced, and the secretory signal peptide sequence (from yeast Wbp1 signal peptide The sequence, shown in SEQ ID NO.1, is specifically:

[0075] MARVMRTDWNFFFCILLQAIFVVGTQTSRTLVLYSK) transmembrane peptide (from yeast Wbp1 transmembrane peptide sequence, shown in SEQ ID NO.2, specifically:

[0076] TGEFILPDRHGVFTFLTDYRKIGLSFTTDKDVKAIRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFVTTSSVGKKLETFKKT) was fused, and then the green fluorescent protein (EGFP) reporter gene was connected, and the entire fusion protein wa...

Embodiment 2

[0080] Example 2. Construction and positioning of CXCR4 receptor protein vector

[0081] Objective: To clarify the expression localization of CXCR4 receptor in yeast cells.

[0082] Vector construction: the CXCR4 receptor gene was cloned, fused with yellow fluorescent protein (YFP), and cloned into the yeast expression vector pGBK-T7 ( Image 6 A), denoted as: CXCR4-YFP plasmid. Among them, the relevant information of CXCR4 is detailed in:

[0083] CXCR4 Reference HTTP: / / WWW.UNIPROT.ORG / UNIPROT / P70658 ;(NP_034041.2)

[0084] Prediction of transmembrane structure of fusion protein: use TMHMM2.0 online analysis software to analyze the transmembrane topology of fusion protein. The software calculation results show that the fusion protein can correctly express the receptor protein to the cell membrane, and express the YFP protein fused to the C-terminus into the cell ( Image 6 B).

[0085] Plasmid transfection: transform the CXCR4-YFP plasmid into the Y187 cell line by LiA...

Embodiment 3

[0087] Example 3. Establishment of CXCL12-CXCR4 Interaction Detection Platform

[0088] Example Purpose: To establish a detection platform for the interaction between CXCL12 and CXCR4 by bimolecular fluorescence complementation technology for subsequent screening of receptor antagonists.

[0089] Principle: The ligand gene CXCL12 (NP_038683.1) is fused with the C-terminal domain of yellow fluorescent protein (CYFP) through a transmembrane peptide, and the receptor CXCR4 (NP_034041.2) is fused with the N-terminal domain of yellow fluorescent protein (NYFP). Neither NYFP nor CYFP can fluoresce alone. Only when CXCL12 interacts with CXCR4, NYFP and CYFP undergo bimolecular fluorescence complementation (BiFC) and reconstitute into a complete active yellow fluorescent protein (YFP) with fluorescent function. The intensity of the yellow fluorescence (wavelength 529 nm) of the bacterial solution was detected by a fluorescent microplate reader.

[0090] Plasmid Construction: CXCL12-C...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
absorbanceaaaaaaaaaa
Login to View More

Abstract

The invention provides a high-flux prey antagonist screening method based on membrane binding protein and fluorescence complementation, relates to the field of gene engineering, and concretely discloses a novel method for screening a receptor antagonist and application thereof. According to the method, a ligand existing outside a cell and a receptor are expressed to the cytomembrane through a signal peptide fusion expression strategy; a ligand structural domain generating mutual action with the receptor is enabled to be remained at the outer side of the cytomembrane; the ligand is coupled with intracellular effect proteins through transmembrane peptide; the ligand and the receptor take mutual effects at the outer side of the cytomembrane, or the effect proteins coupled in the cells are antagonized; and the effect is converted into a macroscopical biological effect, so that the method is provided for the screening of the secretion type ligand and receptor antagonists.

Description

technical field [0001] The invention relates to the field of genetic engineering, and specifically discloses a new method for screening receptor antagonists and its application. Background technique [0002] Antagonist refers to a class of substances that can bind to receptors but do not have the biological function of activating receptors. Its biological function is opposite to that of agonists. It inhibits downstream physiological responses by blocking signal transduction , is an important class of drugs. Antagonists broadly include small molecular compounds, recombinant proteins, antibodies, etc. that can antagonize protein interactions, among which small molecular compound antagonists are the most widely used. Receptor antagonist screening is of great significance in drug development. For example, CXCR4 antagonists AMD3100 and ALX40-4C can inhibit the tumor growth of some CXCR4-related tumors by antagonizing the interaction between CXCL12 and CXCR4; the endothelial gro...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): C12Q1/02C12N15/81C12N1/19
Inventor李京敬
OwnerSHANGHAI JIAOTONG UNIV