Method for extracting enhanced VPR (viral protein regulatory) protein and plasma free nucleic acid
An enhanced, protein technology, applied in the field of biomedicine, can solve problems such as nucleic acid degradation, and achieve the effect of reducing nucleic acid degradation, high activity, and high catalytic activity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment approach
[0062] According to a typical embodiment of the present invention, a recombinant plasmid is provided. The recombinant plasmid contains any one of the above DNA molecules. The DNA molecules in the above recombinant plasmids are placed in appropriate positions of the recombinant plasmids, so that the above DNA molecules can be replicated, transcribed or expressed correctly and smoothly.
[0063] Although the qualifier used in the present invention is "contains" when limiting the above-mentioned DNA molecule, it does not mean that other sequences irrelevant to its function can be arbitrarily added to both ends of the DNA sequence. Those skilled in the art know that in order to meet the requirements of recombination operations, it is necessary to add suitable restriction endonuclease cutting sites at both ends of the DNA sequence, or additionally add start codons, stop codons, etc., therefore, if using A closed-ended statement will not truly cover these situations.
[0064] The ...
Embodiment 1
[0070]Prepare buffers for magnetic bead nucleic acid extraction, including lysis buffer, washing buffer and elution buffer. The high-concentration salt composition of the lysis buffer is one or more of the following: 2-3M guanidine hydrochloride, 4.5-6M guanidine isothiocyanate, 1.5-3M sodium iodide, and the like. Other ingredients are: 1%-30% Triton X-100, 10-50mM tris-hydrochloride (Tris-Cl), 1-10mM sodium ethylenediaminetetraacetate (EDTA).
[0071] Component A of the washing buffer solution is: 2-3M guanidine hydrochloride, 1%-30% Triton X-100, 5-50mM tris-hydrochloride (Tris-Cl), 1-10mM Sodium ethylenediaminetetraacetate (EDTA), isopropanol, 70% ethanol.
[0072] Component B of the washing buffer is: 5-50 mM tris-hydrochloride (Tris-Cl), 1-10 mM sodium ethylenediamine tetraacetate (EDTA), and 80% ethanol.
[0073] The composition of the elution buffer is: 8-10 mM Tris hydrochloride (Tris-Cl, pH 8.0).
[0074] The magnetic beads are superparamagnetic nano-magnetic beads...
Embodiment 2
[0088] Comparison of the Activities of Enhanced VPR Protease and Proteinase K at Different Temperatures
[0089] Under 5 temperature conditions (15~55 ℃), measure enhanced VPR protease (SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4, SEQ ID NO:5 and SEQ ID NO:4, SEQ ID NO:5 and SEQ ID NO:4 respectively) ID NO:6) and proteinase K (below) Enzyme kinetic parameters for the hydrolysis of the substrate succinyl-AAPF-p-nitroanilide, K cat / K m Values are calculated according to Michaelis-Menten equation and substrate concentration.
[0090] The amino acid sequence of proteinase K is SEQ ID NO: 12:
[0091] AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
[0092] Enhanced VPR protease (SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4, SEQ ...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com