85results about How to "Reduce degradation" patented technology

The invention discloses a triazine desulfurizer and a preparation method thereof, and belongs to the technical field of gas purification. The triazine desulfurizer is mainly prepared from the following raw materials in percentage by weight: 20 to 50 weight percent of triazine derivative, 10 to 15 weight percent of sterically hindered amine, 3 to 7 weight percent of stabilizer, 1 to 3 weight percent of synergist, 0.5 to 1.5 weight percent of penetrant, 0.5 to 1.5 weight percent of inhibitor, 1 to 2 weight percent of additive and the balance of water, the preparation method of the triazine derivative comprises the following steps: adding 2-(diphenylphosphino) ethylamine into a toluene solvent, adding a paraformaldehyde aqueous solution in batches under a stirring condition, and reacting for 2-8 hours to obtain the triazine derivative. According to the triazine desulfurizer and the preparation method thereof provided by the invention, the triazine derivative and the sterically hindered amine are taken as a host, and the stabilizer, the synergist, the penetrant, the inhibitor and the assistant are compounded, so that the scaling trend of the triazine desulfurizer in an oil and gas well can be slowed down, the dissolution rate of hydrogen sulfide and the mass transfer rate in a solution are increased, and the desulfurization reaction is promoted; the desulfurization effect and the desulfurization rate are improved, and meanwhile, a very good scale inhibition effect is also achieved.

The invention discloses a preparation method of a foamed thermal-insulation ceramic decorative plate in the technical field of building decorative materials. The method comprises the following steps: carrying out ball milling, spray drying, granulating and ageing on raw materials such as ceramic waste and kaolin; mixing and dispersing the aerogel-hydrogel gradient core-shell structure composite modified material and ceramic particles, and sieving to obtain composite powder; compounding sodium bicarbonate and azodicarbonamide with a foaming agent, mixing the foaming agent with the composite powder, and adding a surfactant and a dispersing agent to adjust the viscosity so as to prepare expandable ceramic slurry; the slurry is injected into a mold and coated with low-temperature glaze, and stepped heating sintering is conducted through a tunnel kiln and comprises the steps of preheating glue discharging, primary foaming, secondary sintering, gradient cooling and the like. The thermal insulation performance, the mechanical strength, the weather resistance and the decoration performance are synergistically improved, and the product is low in heat conductivity coefficient, high in compressive strength, excellent in ultraviolet aging resistance, firm in decoration layer combination and suitable for building outer walls and other scenes.

This application provides a display panel, its manufacturing method, and an electronic device. The manufacturing method includes sequentially fabricating an array of anode layers on one side of a substrate; fabricating a pixel definition layer covering the substrate and the peripheral areas of each anode layer, such that the pixel openings of the pixel definition layer expose the central area of ​​the anode layer; and forming a polymer film on the surface of the pixel definition layer away from the anode layer under first design conditions, where the first design conditions include oxygen. In this application embodiment, the formation of the polymer film requires oxygen consumption, which helps reduce oxygen infiltration, thereby reducing the oxygen concentration on the anode surface, thus reducing the surface voltage of the display panel and improving its lifespan.

The present application relates to the low temperature curing high-strength benzoxazine type silicone adhesive formula and use method, the formula includes the benzoxazine group containing organic silicon compound and organic alkali compound, the mass ratio of benzoxazine group containing organic silicon compound, organic alkali compound is 100:0.1-20.The adhesive of the present application is based on the cooperation between the benzoxazine group containing organic silicon compound and the basic catalyst, can be cured at low temperature, realize the higher strength bonding.The benzoxazine type silicone adhesive formula provided by the present application can be directly used as adhesive, and the bonding strength is high;It can also be used as a basic formula, used as an adhesive after adding other fillers, to meet the different needs of various special occasions.

The application provides a cold-dissolved liver-protecting medicinal tea and a preparation method and application thereof. The preparation raw materials of the cold-dissolved liver-protecting medicinal tea include green tea, rattan tea, ginseng, lotus leaves, mulberries and hawthorn. The preparation method comprises the steps of grouping extraction and spray drying of the preparation raw materials. The air inlet temperature of the spray drying is 130-150 DEG C, and the air outlet temperature is 75-85 DEG C. The grouping extraction comprises jointly extracting the ginseng, mulberries and hawthorn, and jointly extracting the green tea, rattan tea and lotus leaves in the presence of cyclodextrin. The cyclodextrin comprises one or more of beta-cyclodextrin and hydroxypropyl-beta-cyclodextrin. The cold-dissolved liver-protecting medicinal tea is derived from natural plants, has a simple formula, is safe and effective, is convenient to use, and can retain active ingredients to the greatest extent.

This application discloses a seaweed oligopeptide fertilizer for promoting root growth and seedling development, and its production process, belonging to the field of fertilizer technology. The fertilizer, by weight, comprises: 2-10 parts seaweed oligopeptide complex, 1-8 parts seaweed extract, 10-30 parts compound amino acids, 1-10 parts blueberry pomace, 20-50 parts oxytetracycline waste decomposition products, and 30-60 parts recycled organic matter from kitchen waste. By combining seaweed oligopeptides with chitosan to form a complex, the stability of the active ingredients is improved; simultaneously, the synergistic utilization of oxytetracycline fermentation waste, kitchen waste, and blueberry pomace achieves resource utilization. Experiments show that this fertilizer significantly promotes crop root growth and seedling development.

This application relates to the field of biomedical technology, specifically disclosing a highly liquid-stable SUMO fusion influenza B NP antigen and its preparation method. The antigen is a fusion protein of a SUMO-tagged peptide and an influenza B virus nucleoprotein NP. The SUMO-tagged peptide is directly linked to the N-terminus of the influenza B virus nucleoprotein NP via peptide bonds. The antigen is dissolved in a storage buffer for liquid preservation. The preparation method includes key steps such as fusion gene construction, vector engineering construction, host transformation screening, induced expression culture, and bacterial cell disruption and purification. This antigen can be used for clinical detection of influenza B virus, preparation of quality control materials, and immunogen development. It exhibits excellent liquid preservation stability, maintaining good immunoreactivity even after long-term storage under low-temperature liquid conditions. The preparation method of this application is simple and controllable, requiring no inclusion body refolding step, and can efficiently obtain high-purity and homogeneous soluble fusion antigen.

The application relates to a multifunctional spherical Prussian blue nanolaser and a preparation method and application thereof, and belongs to the field of nanobiological materials and biological medicine. The nanolaser takes spherical Prussian blue nanoparticles as a main body structure, has good near-infrared photothermal response performance and active oxygen (ROS) removal capacity, and can improve the superoxide dismutase (SOD)-like catalytic activity and antioxidant performance by doping metal elements such as ruthenium, bismuth and manganese. The nanolaser can generate a mild photothermal effect of 38-45 DEG C under near-infrared laser irradiation, and cooperatively remove excessive active oxygen in an inflammatory microenvironment, thereby reducing the expression of inflammatory factors and matrix metalloproteinases, inhibiting the activation of the iezo1 / Piezo2 / MMP13-related inflammatory and matrix degradation pathways, and relieving oxidative stress damage and inflammatory reactions. The nanolaser has the characteristics of uniform particle size, good dispersibility, high stability and excellent biocompatibility, and can be used for the prevention of diseases such as osteoarthritis and rheumatoid arthritis. The application constructs a nanolaser system with mild photothermal regulation and antioxidant activity.

The invention discloses an optimization process for preparing hydrolysis-resistant PET (polyethylene terephthalate) master batch. The optimization process comprises the following steps: S1, pretreating raw materials; s2, low-temperature pre-dispersion: adding the dried raw materials weighed according to the formula proportion into a high-speed mixer, so that the anti-hydrolysis agent and the auxiliary agent are uniformly attached to the surface of the PET base material to form a premix; s3, mild extrusion granulation: melting and mixing the premix through a twin-screw extruder, and extruding the premix into filaments through a die head; s4, the filaments are rapidly cooled and shaped through a cooling water tank, and secondary cross-linking is avoided; s5, pelletizing by adopting a pelletizer to obtain primary master batches; s6, the primary master batch is subjected to vacuum drying, surface moisture is removed, and the anti-hydrolysis PET master batch is obtained.The thermal degradation of a PET base material and the advanced reaction of an anti-hydrolysis agent are reduced, the intrinsic viscosity of the master batch is stable, and the anti-hydrolysis efficiency is improved.

The application relates to the technical field of high polymer materials, and discloses a nylon material and a preparation method and application thereof. The nylon material comprises the following preparation raw materials in percentage by mass: 70-85% of nylon resin, 8-15% of nitrogen-based flame retardant, 2-8% of phosphorus-based flame retardant and 1-8% of synergistic flame retardant. The nylon material provided by the application adds the phosphorus-based flame retardant and the synergistic flame retardant in a traditional nitrogen-based flame retardant system, so that the ignition temperature of the material is increased, the dropping speed and the dropping ignition probability are reduced, and the flame retardant performance of the material is improved. The ignition temperature of the material can reach 745 DEG C, the DSC crystallization temperature can reach 187 DEG C, the demolding effect is good, the dropping speed is slow, the dropping ignition probability is low, the performance requirements of a battery assembly product on the material can be met, and the nylon material can be used in the preparation of electronic connectors, battery compartments, low-voltage switches, housings or terminal blocks of power distribution systems of electronic and electrical equipment.

The invention relates to the technical field of heat stabilizers, in particular to a high-temperature-resistant heat stabilizer and a preparation method thereof. The invention discloses a high-temperature-resistant heat stabilizer which comprises the following raw materials in parts by weight: 16-21 parts of a zinc salt stabilizer; 4-10 parts of a calcium salt stabilizer; 7 to 10 parts of stearoyl benzoyl methane; 8-12 parts of a nitrogen-containing heterocyclic compound; 48 to 60 parts of hydrotalcite; 14 to 20 parts of an antioxidant; and 3-9 parts of a lubricant. Through the synergistic effect of the zinc salt stabilizer and the calcium salt stabilizer and in combination with multiple stabilization mechanisms of the nitrogen-containing heterocyclic compound and hydrotalcite, the thermal stability of PVC in high-temperature processing and use environments is remarkably improved.

The application discloses a solid dispersion of olaparib and a preparation method thereof, and belongs to the technical field of pharmaceutical preparations. The solid dispersion of olaparib adopts polyvinyl alcohol or polyvinyl alcohol and a plasticizer or polyvinyl alcohol and copolymerized povidone or polyvinyl alcohol, copolymerized povidone and an anti-sticking agent as a matrix polymer carrier, can effectively protect the olaparib raw material, reduce the degradation, and improve the drug loading of the solid dispersion. The solid dispersion of olaparib has small hygroscopicity, reduces the requirement of the environment humidity during the storage of the intermediate product of the olaparib preparation, reduces the energy consumption during the preparation process, and significantly improves the stability and effectiveness of the preparation.

The application belongs to the technical field of biological medicine, and more particularly relates to nanoparticles TK-PSBs / CBD@Met, a preparation method therefor and application thereof. The nanoparticles TK-PSBs / CBD@Met are nanoparticles formed by wrapping cannabidiol and metformin with thione-modified lung surfactant biomimetic liposomes. In vitro experiments have confirmed that the nanoparticles TK-PSBs / CBD@Met can effectively inhibit the fibrosis process of BEAS-2B cells induced by silicon dioxide. Animal experiments have shown that the nanoparticles TK-PSBs / CBD@Met can significantly improve the damage to the lung tissue structure and abnormal deposition of collagen caused by SiO2 exposure, and alleviate the pathological progression of silicosis fibrosis.

The application provides a high-activity rhodiola extract freeze-dried powder and a preparation method and application thereof.The high-activity rhodiola extract freeze-dried powder is composed of the following components in parts by weight: rhodiola extract: 10-20 parts; mannose: 78-89 parts; xanthan gum: 1-2 parts; and other pharmaceutically acceptable adjuvants: 0-10 parts. The rhodiola extract, mannose and xanthan gum are compounded in the application, wherein the xanthan gum and the mannose are not only simple supporting agents and protective agents, but also have a synergistic effect with the rhodiola extract, and the activity is improved by 1+1+1>3. Experimental data prove that the anti-inflammatory effect of the high-activity rhodiola extract freeze-dried powder is significantly improved, and the analgesic activity is well maintained.

The application provides a Bi2O2CO3-MIL-68(In) heterojunction composite material and a preparation method and application thereof, and belongs to the technical field of photocatalytic materials, the field of persulfate catalysis and the field of environmental governance. The composite material is obtained by loading Bi2O2CO3 on the surface of MIL-68(In) to form a Z-type heterojunction structure; the Bi2O2CO3 is a spherical body with a diameter of 200-500 nm, and the surface is a stacked granular structure; the MIL-68(In) is a regular hexahedral rhombic rod-shaped structure with a particle size of 5-10 mu m, and the Bi2O2CO3 is dispersedly loaded on the surface of the MIL-68(In). The application has the advantages of simple operation, strong visible light absorption capacity of the heterojunction material, stable photocatalytic performance, high degradation efficiency and the like, and has a potential application prospect in the field of photocatalytic persulfate.

The utility model relates to the field of agricultural mulching films, mainly aims to solve the problem that the existing PBAT agricultural mulching film is insufficient in ultraviolet shielding effect, and provides an anti-ultraviolet PBAT composite degradable agricultural mulching film which is characterized by comprising a front packaging layer 1 serving as an illuminated surface, an ultraviolet shielding layer 2 and a back packaging layer 3 serving as a soil contact surface which are sequentially stacked, the ultraviolet shielding layer 2 comprises a structural body formed by compounding PBAT and a nanoscale ultraviolet shielding material, the nanoscale ultraviolet shielding material is of a micro-nano composite structure formed by uniformly mixing a nano sheet layer and a micron sheet layer in the ultraviolet shielding layer 2, and the nanoscale ultraviolet shielding material is arranged in a PBAT matrix in an oriented mode to form a brick mud structure. The PBAT degradable composite mulching film can effectively ensure visible light transmission and excellent mechanical properties, can reduce aging and degradation of the mulching film caused by ultraviolet radiation, and can be expected to be used in the agricultural field, especially in the agricultural field especially needing anti-ultraviolet shielding.

The utility model relates to the field of notebook computer structures, in particular to a splicing notebook computer mainboard tray. The keyboard comprises a keyboard shell, keyboard holes, heat dissipation holes, a mounting frame, a splicing mainboard tray, splicing grooves, magnetic attraction pieces and heat dissipation grooves. The keyboard holes are formed in the keyboard shell, the two sets of heat dissipation holes are formed in the two sides of the keyboard holes, the installation frame is installed in the keyboard shell, the splicing mainboard trays are installed on the installation frame, the splicing mainboard trays comprise the first mainboard tray and the second mainboard tray, and the first mainboard tray and the second mainboard tray are arranged in the keyboard shell. The splicing grooves are formed in peripheral edge openings of the first mainboard tray and the second mainboard tray, the magnetic attraction pieces are attached to groove openings of the splicing grooves, and the heat dissipation grooves are distributed in the splicing mainboard trays. The first main board tray and the second main board tray are spliced and assembled into the whole main board tray for application, if one position is damaged, only the damaged splicing part needs to be replaced, and waste of the whole disposable tray is reduced.

The invention relates to the technical field of film materials, in particular to an ultraviolet-proof barrier coating film and a manufacturing method thereof.The ultraviolet-proof barrier coating film comprises a polyethylene glycol terephthalate base material layer, an anchoring layer and an ultraviolet barrier layer, the anchoring layer and the ultraviolet barrier layer are sequentially stacked on the surface of one side of the base material layer, and the anchoring layer is a coating formed by curing a main film forming substrate; the ultraviolet blocking layer is a composite coating containing polyurethane acrylate resin, a photoinitiator, an ultraviolet light absorber, nano zinc oxide and nano montmorillonite. According to the invention, through optimized chemical composition and process parameters, firm interface bonding between layers and a compact network structure are realized, so that a high initial ultraviolet protection coefficient and ultraviolet aging resistance durability are synergistically obtained.

This invention discloses a casting process for high-strength ductile iron, relating to the technical field of cast iron materials and casting processes. The process includes the following steps: S1, preparing a sand mold, and sequentially forming a sulfur-blocking layer, a diffusion-regulating layer, and a slow-release post-inoculation layer on the surface of the mold cavity to obtain a mold with a gradient reaction coating; S2, melting the base iron, and subjecting the base iron to spheroidization treatment and a primary inoculation treatment to obtain spheroidized iron to be poured; S3, pouring the spheroidized iron to be poured into the mold with the gradient reaction coating, allowing the slow-release post-inoculation layer to contact the spheroidized iron to be poured and release interfacial inoculation active particles; the surface coating of the mold is designed as a gradient structure of a sulfur-blocking layer, a diffusion-regulating layer, and a slow-release post-inoculation layer, so that sulfur blocking, diffusion blocking, and interfacial post-inoculation are spatially partitioned and temporally coordinated, avoiding premature reaction and inoculation failure caused by simple mixing of sulfur-blocking powder and inoculator.

The present application relates to TAT-PO1 and its application in treating amyotrophic lateral sclerosis (ALS). The polypeptide connects TAT sequence (SEQ ID NO. 1) and PO1 sequence (SEQ ID NO. 2) through amino hexanoic acid (AHX), and its amino acid sequence is YGRKKRRQRRR{AHX}RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. TAT-PO1 can competitively block the interaction between PGAM5 and OMA1, thereby interfering with the pathological mechanism of ALS. The polypeptide TAT-PO1 of the present application can be prepared into a drug, and directly targets the central nervous system through intrathecal injection or intravenous administration, thereby providing a new strategy for the treatment of ALS. In addition, the design idea can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, thereby providing a technical paradigm for the development of related drugs.

The application discloses a night work activating composition containing multiple plant extract, which comprises the following components in mass: 3-5 parts of extract A, 10-15 parts of extract B, 2-4 parts of extract C, 1.5-3 parts of curcumin nano-liposome, 2-5 parts of lactobacillus fermentation filtrate, 1-3 parts of lock water magnetite, 0.1-0.3 parts of xanthan gum / acrylate compound thickening agent and 0.5-1 part of preservative composition. The night work activating composition containing multiple plant extract of the application is compounded by extract A with methyl jasmonate as a target component, extract B with rhodioside and syringic acid as target components and curcumin nano-liposome, compared with the same kind of products on the market, the antioxidant and anti-glycation capacity of the night work activating composition can be targetedly strengthened, the transdermal efficiency is improved, and the DNA repair effect and anti-inflammatory effect are improved.

The invention relates to a flexible anti-aging PVC (polyvinyl chloride) material as well as a preparation method and application thereof, and belongs to the technical field of high polymer materials. The material comprises the following raw materials: PVC resin, a plasticizer, a stabilizer, a filler and reactive core-shell nanoparticles containing polyester chain segments and epoxy groups. According to the reactive core-shell nanoparticles, nano silicon dioxide is used as an inorganic core, an organic shell layer containing an epoxy-terminated polybutylene adipate chain segment is chemically bonded on the surface of the reactive core-shell nanoparticles, and the reactive core-shell nanoparticles react with a PVC molecular chain through an epoxy group at the tail end of the reactive core-shell nanoparticles in the material processing process. Through the synergistic effect of the core particles and the compound additive, migration, volatilization and extraction of the plasticizer are effectively inhibited, long-term flexibility maintenance is realized, thermo-oxidative aging resistance is remarkably improved, and the material is excellent in environmental protection property and high in processing adaptability and can meet the use requirements of wire and cable insulating sheath materials.

The application discloses collagen tripeptide and a preparation method and application thereof, and belongs to the technical field of bioengineering. The preparation method comprises the following steps: obtaining bacillus velezensis with high collagenase yield through separation and identification, the bacillus velezensis belongs to probiotics, and high-activity collagenase is obtained through fermentation culture and purification; taking shark cartilage or blue fish skin as raw materials, and obtaining collagen tripeptide through the following steps of combined enzymolysis of alkaline protease and collagenase after pretreatment, inactivation, centrifugal separation and freeze-drying. The collagen tripeptide prepared by the application has a molecular weight of less than 500 Dalton, contains active components such as GHK tripeptide, is easy to absorb and has high safety, and can be used for preparing antioxidant products, anti-inflammatory products, memory-enhancing products or immunity-enhancing products. The application solves the problems of unsafe collagenase source and low collagen tripeptide preparation efficiency, and has a good industrial application prospect.

The utility model discloses a multifunctional device for controlling the constant temperature of a film blowing machine for mulching film processing, and relates to the technical field of mulching film processing equipment. The device comprises a support, a bottom plate is fixedly connected to the inner bottom of the support, and an extrusion barrel is fixedly connected to an inner cavity of the support; a switching assembly is arranged at the top of the bottom plate and comprises a supporting frame fixedly connected to the top of the bottom plate and a first lead screw movably connected to one side of an inner cavity of the supporting frame. Through the synergistic effect of the switching assembly and the clamping assembly, a standby heating system can be rapidly switched when main constant-temperature equipment breaks down, shutdown replacement is not needed, the production interruption time is remarkably shortened, it is ensured that the heating device is tightly attached to the extrusion barrel through the magnetic attraction and clamping design of the closed ring, stable heat transfer is maintained, and it is ensured that the plastic melting temperature is uniform; therefore, the thickness consistency of mulching film finished products is improved, the rejection rate is reduced, and the overall production efficiency is improved.

This invention relates to a biodegradable anti-stick film and its preparation method. The biodegradable anti-stick film comprises a top layer, a middle layer, and a bottom layer arranged sequentially. The top layer comprises polyadipate, polylactic acid, polybutylene butyrate, a compatibilizer, a chain extender, and a dual-antibiotic masterbatch. The middle layer comprises polyadipate, polyglycolic acid, polybutylene butyrate, a compatibilizer, a chain extender, and a dual-antibiotic masterbatch. The bottom layer comprises polyadipate, polylactic acid, polybutylene butyrate, a compatibilizer, a chain extender, and a dual-antibiotic masterbatch. Its advantages lie in the following: adding a compatibilizer to each layer improves the compatibility of the raw materials, thereby reducing the brittleness of the biodegradable anti-stick film; adding PBAT-carrier dual-antibiotic masterbatch to each layer controls the degradation rate of the biodegradable anti-stick film; adjusting the blending ratio of each layer component improves the mechanical properties, processing flowability, and biodegradability of the biodegradable anti-stick film; and coating the top layer with a UV-curable release coating ensures the application requirements of the biodegradable anti-stick film.

The invention discloses a composite extract for improving sleep and a preparation method thereof, and belongs to the technical field of plant extraction. According to the invention, four medicinal materials of spina date seed, lily, lotus seed and poria cocos which are homologous in medicine and food and have the effect of soothing the nerves are scientifically combined, and the composite extract for improving sleep is obtained by adopting a specific extraction process; according to the technology, active ingredients are efficiently released through the synergistic effect of cellulase, pectinase and acid protease, and the yield of gamma-aminobutyric acid and other sedative substances is remarkably increased through a co-fermentation system of lactobacillus plantarum and saccharomyces cerevisiae; lipid-soluble effective components are extracted by adopting glycyrrhizic acid and rhamnolipid assisted ultrasonic extraction technology, and finally, embedding protection of the active components is realized through a chitosan oligosaccharide-soybean lecithin system, so that thermal degradation and oxidation loss in the processing process are reduced, and compared with a traditional single extraction method, the preparation method has the advantages that the cost is reduced; according to the method, high-yield gamma-aminobutyric acid, jujuboside, triterpenic acid and other active ingredients can be obtained at the same time, and the effect of the composite extract is improved.

The application discloses instant flower glue with high elasticity and high glycosaminoglycan retention rate and a preparation method thereof. After cleaning and steaming of the flower glue, the flower glue is soaked in water below 20 DEG C, then mixed and dissolved with donkey-hide gelatin instant powder, milk and granulated sugar, sealed, filled and sterilized, and finally cooled by water cooling, with the cooling rate controlled within 10-15 DEG C / min, so that the center temperature of the product is steadily decreased to 25+ / -0.5 DEG C, and the instant flower glue is prepared. The instant flower glue prepared by the method has excellent texture characteristics, Q elastic and smooth, and does not stick to teeth. The flower glue has good water retention, and the proportion of free water is as high as 85% or more. Most importantly, the method maximally retains glycosaminoglycan in the flower glue, and the degradation of active ingredients such as chondroitin sulfate is reduced, and the dry base content is high.

This invention belongs to the field of food processing technology and discloses a method for producing anthocyanin-enriched antioxidant jelly from black chokeberry. By weight, the raw materials include: 6.5-19.5 parts black chokeberry, 3.5-10.5 parts persimmon, 7-21 parts erythritol, 0.4-1.2 parts carrageenan, 0.4-1.2 parts konjac gum, and the remainder being drinking water. The method employs a persimmon compound astringency removal process to eliminate the astringency of the black chokeberry itself; uses erythritol, a natural sugar substitute, to replace sucrose as a sweetener, which reduces calories and avoids masking the natural flavor of anthocyanins; and utilizes a compound gum to form the jelly, combining the anthocyanins of black chokeberry with the jelly; thus developing a low-sugar, healthy, functional food to meet consumers' demand for healthy snacks.

The application belongs to the technical field of food, and particularly relates to an antioxidant solid beverage and a preparation method thereof. The antioxidant solid beverage is characterized by comprising the following components: polyphenol raw materials, collagen peptide, fructo-oligosaccharide, pyrroloquinoline quinone disodium salt, and fruit and vegetable powder as a flavoring agent added or not added. The addition of fructo-oligosaccharide can improve the preservation rate of polyphenol substances and fully exert the antioxidant effect. The application further provides a preparation method, which can ensure the mixing uniformity of trace, heat-sensitive and unstable raw materials in the solid beverage and effectively protect the activity of effective components in the product.

This invention discloses a nutritional composition and preparation method for improving joint health in senior pets. The nutritional composition comprises: N-acetylglucosamine, chondroitin sulfate, methanesulfonylmethane, unsaponifiable avocado and soybean extract, hyaluronic acid, curcumin microcapsule powder, and high-concentration fish oil. This invention uses a lipid / polysaccharide bilayer microcapsule structure to encapsulate curcumin and fish oil, and prepares the product through low-temperature homogenization, spray drying, and granulation processes. The composition of this invention works synergistically through multiple pathways, simultaneously exerting effects on three key levels: anti-inflammation, lubrication, and cartilage repair. It can significantly inhibit joint inflammation, improve joint lubrication, and promote cartilage repair. This invention solves the problems of existing pet joint products, such as single pathways of action, low stability and bioavailability of lipid-soluble active ingredients, and lack of overall formulation optimization tailored to the characteristics of aging pets. It is suitable for daily joint health maintenance or adjunctive treatment in middle-aged and senior dogs and cats.