A kind of glp-1 mutant and its preparation method and use
A GLP-1 and mutant technology, applied in the field of genetic engineering, can solve the problems of patients' physical and psychological pain, poor medication compliance, inconvenient use and carrying, etc., and achieve good clinical application prospects, reduce degradation, and avoid pain Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] Embodiment 1 Screening and activity detection of mutant sequences of the present invention
[0030] Starting from the original sequence of GLP-1, 4 mutant polypeptide sequences were modified and designed, and through chemical synthesis (Zhongpeptide Biochemical), a polypeptide product with a purity of up to 85% was obtained. The peptide sequence is as follows:
[0031] GLP-1 Fragment (7-37aa): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
[0032] GM (SEQ ID NO: 1):
[0033] HHEGTFTSDVSSYLEGQAAKKFIAWLVRGGKKKKKYGRKKRRQRRREF
[0034] C33: HACGFTTSDVSSYLEGQAAKEFIAWLCKGRG
[0035] K34: HAEGTFTSDVSSYLEGQAAKEFIAWLVKKKK
[0036] R34: HAEGTFTSDVSSYLEGQAAKEFIAWLVRRRR
[0037] GM is based on the original sequence of GLP-1, mutating the 8th alanine of GLP-1 to histidine, the 27th glutamic acid to lysine, and the 34th lysine to arginine acid, arginine at position 36 is mutated to glycine, glycine at position 37 is mutated to lysine, and a sequence is added at the end.
[0038] C33 is base...
Embodiment 2
[0050] Embodiment 2 Recombinant Escherichia coli expression and activity verification of mutants of the present invention
[0051] 1. Escherichia coli expression of the GLP-1 mutant of the present invention
[0052](1) Add a signal peptide sequence before the sequence of GLP-1 mutant GM, add HIV membrane-penetrating peptide sequence and 6 His-tag sequences at the 3'-end, and construct a protein that can be secreted and expressed and has the ability to pass through the cell membrane The nucleotide sequence of the GLP-1 mutant is shown in SEQ ID NO:2.
[0053] SEQ ID NO: 2:
[0054] atgaaaaagaacatcgcattcctcctggcatctatgtttgttttctctatcgctaccaacgcttacgctggatcccaccacgagggcaccttcacctccgacgtgtcctcctacctggagggccaggccgccaagaagttcatcgcctggctggtgcgcggcggcaagaagaagaagaagtacggccgcaagaagcgccgccagcgccgccgcctcgaggacgacgacgacaagcaccatcaccatcaccattaa
[0055] (2) Cloning the nucleotide sequence shown in SEQ ID NO: 2 into the BamHI and SalI sites of the Escherichia coli expression vector pGEX t...
Embodiment 3
[0060] Embodiment 3 Recombinant lactic acid bacteria expression and activity verification of mutants of the present invention
[0061] 1. Lactic acid bacteria expression of the GLP-1 mutant of the present invention
[0062] (1) Cloning GLP-1GM, namely the nucleotide sequence shown in SEQ ID NO: 2, into the SalI and HindIII sites of the lactic acid bacteria expression vector pMG36e plasmid, and picking a single colony of the recombinant lactobacillus after electrotransformation of the lactic acid bacteria After culturing, the plasmid is extracted, and the GLP-1GM gene is detected in the recipient bacterium by PCR inspection and sequencing.
[0063] (2) Inoculate the above-mentioned recombinant lactic acid bacteria on the MRS medium supplemented with erythromycin at a final concentration of 20 μg / ml, and culture statically at 30°C until OD 600 When the value reaches 0.8-1.0, centrifuge, discard the supernatant, take the bacteria, and set aside.
[0064] 2. Activity verificatio...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


