Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Human secretory FNDC5 protein as well as preparation method and application thereof

A FNDC5-R, secreted technology, applied in the field of genetic engineering

Active Publication Date: 2020-10-23
THE SECOND HOSPITAL OF SHANDONG UNIV
View PDF4 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] FNDC5 is the precursor protein of irisin, and there are few studies on it at present. The new subtype of human-derived FNDC5 protein that does not contain a transmembrane domain and can be directly secreted and its application in various diseases have not yet been investigated. been reported

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Human secretory FNDC5 protein as well as preparation method and application thereof
  • Human secretory FNDC5 protein as well as preparation method and application thereof
  • Human secretory FNDC5 protein as well as preparation method and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0043] A human-derived secreted FNDC5 protein does not contain a transmembrane domain and can be directly secreted and released into the blood. The amino acid sequence of the human-derived secreted FNDC5 protein is SED ID NO: 1:

[0044] IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPAVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWGLHILPSHPGFHESYPGSSCPSLEPEWCEVTGLSLHCPFLV;

Embodiment 2

[0046] The preparation method of the human-derived secreted FNDC5 protein described in embodiment 1 comprises the following steps:

[0047]1. Design primers from different sites at the C-terminus of the FNDC5 gene, perform PCR, run electrophoresis, and detect FNDC5 subtypes that are different from the C-terminals of the three known FNDC5 isoforms reported in Pubmed (that is, new FNDC5 isoforms body), specifically:

[0048] The primers are:

[0049] Upstream primer FNDC5-F: TGAGGCCGAGAAGATGGCCTCTAA;

[0050] Downstream primer FNDC5-R: TAGTGACAATGGCTGCTCTCTGCC;

[0051] Extract RNA from Blox5 cells, reverse transcribe into cDNA, and use the above primers for PCR;

[0052] PCR reaction system:

[0053] h 2 O: 36.75 μl

[0054] Go Taq DNA Polymerase: 0.25 μl (Promega)

[0055] 5x Go Taq Buffer: 10 μl (Promega)

[0056] FNDC5-F: 1 μl

[0057] FNDC5-R: 1 μl

[0058] cDNA: 1 μl

[0059] Total: 50μl

[0060] 94°C for 5 minutes;

[0061] 94°C for 30 seconds, 56°C for 30 se...

Embodiment 3

[0154] Application of human-derived secreted FNDC5 protein in the preparation of drugs for treating obesity-related metabolic disorders

[0155] Establishment of obesity model: 6-week-old C57BL / 6 male mice were randomly divided into 3 groups, 6 mice in each group:

[0156] The first group: normal diet mice-normal saline group: negative control group, given normal diet all the time, and intraperitoneal injection of normal saline for 2 weeks after 12 weeks;

[0157] The second group: obese mice-normal saline group: as the positive control group, a high-fat diet was given to make obese mouse models, and after 12 weeks, normal saline was injected intraperitoneally for 2 weeks;

[0158] The third group: obese mice-secreted FNDC5 group: as the experimental group, high-fat diet was given to make obese mouse models, and secreted FDNC5 protein was injected intraperitoneally for 2 weeks after 12 weeks.

[0159] Administration method and administration concentration: The secreted FNDC5 ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a human secretory FNDC5 protein as well as a preparation method and application thereof, and relates to the technical field of gene engineering. The human secretory FNDC5 protein does not contain a transmembrane structural domain and can be directly secreted and released into blood. The human secretory FNDC5 protein can be used for preparing medicines for treating atherosclerosis, medicines for promoting bone formation and medicines for treating aplastic anemia, and can be used for preparing endothelial cell proliferation medicines. After fasting injection is conductedon a high-fat fed obese mouse model, the human secretory FNDC5 protein can effectively reduce the weight of an obese mouse, which shows that the protein can obviously improve body fat metabolism of anobese patient and obviously reduce the levels of plasma cholesterol, free fatty acid and triglyceride, and shows that the protein can obviously improve lipid metabolism disorder of the obese patient.

Description

technical field [0001] The invention relates to the technical field of genetic engineering, in particular to a human-derived secreted FNDC5 protein and its preparation method and application. Background technique [0002] Irisin (irisin) is a protein containing 112 amino acid residues discovered in 2012. It is the product of an unknown protease that cleaves type III fibronectin domain-containing protein 5 (FNDC5). Irisin is a part of FNDC5. cutting product. The three FNDC5 subtypes found so far all contain a transmembrane domain (exon5), which anchors the protein on the cell membrane. The sequence of irisin is highly conserved in mammals. Human, mouse and rabbit irisin The amino acid sequence is exactly the same; however, the C-terminal base sequence of the FNDC5 gene of human and mouse and rabbit (animal source) is different. If the animal-derived FNDC5 protein is directly injected into the human body, rejection may occur due to species issues. In addition to having all t...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/78C12N15/81A61K38/39A61P3/04A61P9/10A61P19/08A61P7/06C12R1/84
CPCA61K38/00A61P3/04A61P7/06A61P9/10A61P19/08C07K14/78C12N15/815
Inventor 唐东起李世武李慧
Owner THE SECOND HOSPITAL OF SHANDONG UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com