Equine infectious anemia virus p26-gp90 recombinant protein as well as preparation method and application thereof
A p26-gp90, equine infectious anemia technology, applied in the direction of botany equipment and methods, biochemical equipment and methods, applications, etc., can solve the problems of difficult grass-roots promotion, achieve pollution-free training, short color development time, specificity strong effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0061] Example 1 Construction of equine infectious anemia virus p26-gp90 fusion protein gene expression vector
[0062] The p26 gene of equine infectious anemia virus was designed according to the protein sequence of NCBI Gene bank: ABE03841. The surface protein (Envelope polyprotein) gp90 gene was designed according to the protein sequence of NCBI Gene bank: AAC24024.
[0063] The amino acid sequence of the p26-gp90 recombinant protein fusion protein is as follows (SEQ ID NO.1):
[0064] EFIDGAGNRNFRPLTPRGYTTWVNTIQQHNLLNEASVNLFGILSVDCTSEEMNAFLDVVPGQAGQKQVLLDALDKIAEDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMTEGIKVMTGKPKAQNIRQGPKEPYPEFVDRLLSQIESEGHSTEITRFLTDTLTIQNANEECRNAMRHLRPEDSLEEKMYACRDFGSTKLSKNSMAESKEARDQEMNLKEESKEEKRRNDWWKIGMFLLCLAGTTGGILWWYEGLPQQHYIGLVAIGGRLNGSGQSNAIECWGSFPGCRPFQNYFSYETNRSMHMNNNTATLLEAYHREITFIYKSSCTDSDHCQEYQCKKVDLINSSSNSVRVVENETTTEYWGFKWLECNQTENLKTILVPENEMVNINDSDTWIPKGCNETWARVKRCPIDILYGIHPIRLCVQPPFFLVQEKGIANNSRISNCGPTIFLGVLEDNKGVIRGNSTICKV...
Embodiment 2
[0069] Example 2 Expression of Equine Infectious Anemia Virus p26-gp90 Fusion Protein
[0070] The equine infectious anemia virus p26-gp90 fusion gene plasmid was transformed into Escherichia coli BL21, spread on LB plates containing 50 μg / mL kanamycin (Shanghai Sangong, product number: K0408), cultured overnight at 37°C, and picked Take a single clone colony, culture it with 300mL LB medium containing the same concentration of kanamycin at 37°C until the OD600 reaches about 0.6, and induce expression with IPTG (Shanghai Shenggong, product number: IB0168) with a final concentration of 1mM. For: 25 ℃, rotating speed 200rpm, 4h. After induction, the culture solution was centrifuged at 4° C. at 7000 rpm for 10 min to collect the bacteria.
Embodiment 3
[0071] Example 3 Purification and renaturation of equine infectious anemia virus p26-gp90 fusion protein
[0072] Use 50mL of loading buffer Binding Buffer (50mM Tris, 0.2M Nacl, pH8.0) 50mL to break up the bacteria; then ultrasonically break, the condition is 550w, ultrasonic 2s, interval 5s, a total of 100 times; finally 12000rpm, 30min, 4°C Collect the supernatant by centrifugation, and the target protein is in the supernatant. Then, it was purified by Ni column, and the target protein was eluted with Elution Buffer (50mM Tris, 0.2M Nacl, 0.5M Imidazole, pH8.0). The target protein was detected by PAGE gel electrophoresis, and the results were as follows figure 1 shown.
[0073] Depend on figure 1 It can be seen that the purified fusion protein has a high purity. The purified recombinant protein was dialyzed with a dialysis buffer (50mM Tris, 0.2M Nacl, pH8.0), and the dialysis solution was changed every 12 hours for a total of 3 times. The dialyzed protein solution was ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



