Unlock instant, AI-driven research and patent intelligence for your innovation.

Molecular probe for imaging coronavirus infected living body and preparation method thereof

A coronavirus and molecular probe technology, applied in the field of biomedical applications, to achieve enhanced stability, good application prospects, and improved uptake

Active Publication Date: 2021-06-22
THE FIFTH AFFILIATED HOSPITAL SUN YAT SEN UNIV
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

At present, there is no such type of literature and patent reports at home and abroad.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Molecular probe for imaging coronavirus infected living body and preparation method thereof
  • Molecular probe for imaging coronavirus infected living body and preparation method thereof
  • Molecular probe for imaging coronavirus infected living body and preparation method thereof

Examples

Experimental program
Comparison scheme
Effect test

example 1

[0030] Example 1 Molecular probe 64 Preparation of Cu-NOTA-HR-609

[0031] (1) Synthesis of NOTA-HR-609

[0032] (2) Radioactive labeling reaction

[0033] Dissolve 30-500 μg of labeled precursor NOTA-HR-609 in 100 μL of sodium acetate buffer (0.1-0.5 M, pH = 5.5) (peptides that are not easily soluble can be solubilized by ultrasound), and add 65-85 MBq of [ 64 Cu]CuCl 2 (usually as CuCl 2 The chemical form exists in 0.01 M HCl), and the mixture is reacted at room temperature for 30-60 min (the time is generally controlled within 60 min) to complete the labeling. The labeling rate can be determined by HPLC or TLC. If the labeling rate is greater than 95%, it can be used directly without purification. If the labeling rate is less than 90%, Sep-pak C18 column separation and purification to obtain molecular probes 64 Cu-NOTA-HR-609.

[0034] (3) Radiochemical purity and labeling rate

[0035] Determination of Molecular Probes by Thin Layer Chromatography Radiation Scanner...

example 2

[0036] Example 2 Molecular probe Cy5-HR-609 in vitro cell experiment

[0037] Put HEK293 / SARS-CoV-2 cells stably expressing S protein into flow tubes, 100 μL per tube, 10 5 cells were divided into: a. Negative control, no antibody; b. Positive control, first add anti-S2 antibody, incubate for 30 min, then add AlexaFluor®488-AffiniPure Goat Anti-Human IgG and incubate for 30 min; c. Add Cy5- HR-609, incubate for 1 hour; d. First add anti-S2 antibody and Cy5-HR-609, incubate for 30 minutes, then add Alexa Fluor®488-AffiniPureGoat Anti-Human IgG and incubate for 30 minutes. Analysis was performed using a flow cytometer (CytoFLEX, BECKMAN COULTER). For specific results, see image 3 . In vitro cell experiments show that Cy5-HR-609 has a very strong ability to target target proteins at the cellular level.

example 3

[0038] Example 3 Molecular probe Cy5-HR-609 in vivo animal experiment

[0039] Approved by the Ethics Committee of the Fifth Affiliated Hospital of Sun Yat-sen University, SCID mice were purchased from Guangdong Experimental Animal Center under a suitable environment (21°C, humidity 60%, 15 air circulation / h, 12h light / d, 2 cleanings / d) Eat and drink freely for 2 days, and carry out environmental pre-adaptation. Afterwards, the animals were anesthetized by inhalation of 2.5% isoflurane. HEK293 cells highly expressing or not expressing S protein suspended in PBS were subcutaneously injected into the right axilla for tumor formation in animals. Fluorescent imaging was performed when the subcutaneous tumor reached a diameter of 0.8-1.0 cm. Cy5-HR-609 dissolved in 40% cyclodextrin solution was injected into the tail vein at a dose of 4 mg / Kg, and the image acquisition time was 0 h, 1 h, 2 h, 4 h, 12 h, 24 h, 36 h, 48 h h. A region of interest (Region of Interest, ROI) was draw...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a method of a polypeptide which is derived according to an amino acid sequence of a coronavirus S protein and can specifically recognize a novel coronavirus (including SARS-CoV-2, SARS-CoV or MERS-CoV and the like) S protein and an application of the polypeptide. The method comprises the following steps: 1, the specifically related polypeptide has the following amino acid sequences: SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL; 2, the polypeptide can specifically recognize the new coronavirus S protein in vitro; 3, the polypeptide can be combined with fluorescent markers including but not limited to Cy5 and the like, and can realize cell level or living body level imaging; 4, the polypeptide can label connectors such as NOTA and DOTA, can be combined with radionuclides including but not limited to 18F, 64Cu, 68Ga and the like, and can realize PET / CT imaging of a living body. Therefore, the invention and the derivative thereof can be used as a precursor or a primer for systemic diagnosis of a new coronavirus infection disease (COVID-19) or other similar coronavirus related diseases.

Description

technical field [0001] The invention relates to the field of biomedical application technology, in particular to a fluorescent or radionuclide-labeled molecular probe for systemic diagnosis of coronavirus infection and a preparation method thereof. Background technique [0002] The novel coronavirus pneumonia (COVID-19) caused by the novel coronavirus (SARS-CoV-2) that started in 2019 has caused a global pandemic and poses a serious threat to social development and economic production. The research and development of efficient testing methods for the accurate diagnosis of COVID-19 is of great significance to the prevention and control of COVID-19 infection and the treatment of COVID-19. At present, the diagnosis of new coronary pneumonia mainly relies on nucleic acid detection. Although this method has strong specificity, it has the problem of false negatives due to the limitation of sampling sites and methods (Watson J, BMJ, 2020; 369:m1808. Woloshin S, NEJM , 2020; 383(6)...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/165C07K1/13A61K49/00A61K51/08A61K51/04
CPCC07K14/005A61K49/0056A61K49/0052A61K51/08A61K51/0482C12N2770/20022C12N2770/20031
Inventor 单鸿金红军冼建忠李志军毕蕾杨帅
Owner THE FIFTH AFFILIATED HOSPITAL SUN YAT SEN UNIV