104 results about "Protein servings" patented technology

A powdered pulmonary surfactant preparation containing a hydrophobic protein serving as a pulmonary surfactant is obtained by spray drying an organic solution or suspension containing a hydrophobic protein serving as a pulmonary surfactant and possibly other components. Obtained power preparations exhibit very good stability under storage, are easy to reconstitute and are also suitable for administration by inhalation.

The invention relates to a high dietary fiber full nutrition special application formula food and a preparing method thereof, and belongs to the field of formula food. The high dietary fiber full nutrition special application formula food is prepared from, by weight, 0.7-2.1 parts of protein, 0.4-0.9 part of fat, 2.4-4.5 parts of carbohydrate and 0.3-0.7 part of dietary fiber. According to the high dietary fiber full nutrition special application formula food and the preparing method thereof, through screening and matching of raw and auxiliary materials, the food contains an appropriate amount of protein, carbohydrate and fat needed by people in daily life, and further contains mineral substances and vitamin needed by people, is in accordance to daily need by people, is easy to digest and absorb, can serve as a single nutrition source for people group over 10 years old whose eating is limited, can also serve as nutrition supplementation of a patient before and after a surgery, the product has a low GI value at the same time, contains rich dietary fiber, and is a good nutrient food for control sugar content and facilitating feces excretion.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The invention relates to a method for producing a triple inactivated vaccine for newcastle disease, infectious bronchitis and infectious bursal disease. In the method, the inactivated vaccine is prepared by adopting a newcastle disease virus La Sota strain, an infectious bronchitis virus M41 strain, and an Escherichia coli genetic engineering bacteria E. coil BL21 / pET28a-VP2 strain which expresses an infectious bursal disease virus VP2 protein serving as production bacteria toxic species, a super concentration process and a high-quality adjuvant. After immunizing animals, antibodies are produced rapidly; the potency is high; the protection period is long; and the outbreak and the spreading of epidemic diseases are reduced.

The invention provides an MRGPRX2 protein serving as a protein marker for screening drug anaphylactoid reaction susceptive groups and application thereof. Researches find out that the relative expression of the MRGPRX2 protein in peripheral blood has relevance to drug anaphylactoid reaction susceptivity of testers, and the MRGPRX2 protein can serve as a protein marker for screening the drug anaphylactoid reaction susceptive groups. The relative expression of the MRGPRX2 protein is used for evaluating risk of anaphylactoid reaction of patients occurring in the medication process, and has significance on clinical guiding of pharmacy safety. The method for screening drug anaphylactoid reaction susceptive groups provided by the invention is used for screening occurrence risk of anaphylactoid reaction of the patients and has extremely high susceptivity and specificity. Moreover, since the clinically available peripheral blood is adopted for detection, the method is convenient to use and issuitable for screening of large scale population of patients before medication, advanced discovery of the anaphylactoid reaction susceptive groups is facilitated, and the medication safety is improved.

The invention discloses glycosyl transferase participating in neoandrographolide biosynthesis as well as coding genes and application thereof. The protein provided by the invention is derived from herba andrographitis, and is (a1) or (a5) as follows: (a1) a protein composed of an amino acid sequence shown as a sequence 1 in a sequence table; and (a5) a protein composed of an amino acid sequence shown as a sequence 3 in the sequence table. The invention further discloses application of the protein serving as glycosyl transferase. The glycosyl transferase participates in plant growth and development and secondary metabolism processes. The discovery of the glycosyl transferase and coding genes thereof has important significance. The invention provides a basis for further describing biosynthesis of glycoside compounds in the herba andrographitis, contributes to analyzing a biosynthetic pathway of glycoside active ingredients in the herba andrographitis, and provides novel material basis and gene resources for new drug research and development.

The invention provides a special clinical nutritional formula for lactose intolerance in children. The special clinical nutritional formula comprises the following components in parts by weight: 15-22parts of protein, 6-10 parts of fat, 43-58 parts of carbohydrates, 7-10 parts of dietary fibers, 0.01-0.15 part of major elements, 0.001-0.004 part of trace elements, 0.001-0.003 part of fat-solublevitamins, 0.01-0.03 part of water-soluble vitamins, 0.005-0.02 part of dietary essence, 0.0005-0.05 part of medicinal and edible components, 0.05-0.4 part of a natural plant compound and 0.01-0.02 part of new resource food. The invention also provides preparation methods of two clinical nutritional formulas. The clinical nutritional formula provides comprehensive nutritional support for children with lactose intolerance, intensifies calcium absorption, simultaneously relieves diarrhea symptoms of pediatric patients with lactose intolerance, conditions the intestinal tracts, promotes digestionand absorption of the intestinal tracts and enhances body immunity of children.

The invention relates to a method for producing a quadruple inactivated vaccine for newcastle disease, infectious bronchitis, avian influenza (H9 subtype) and infectious bursal disease. In the method, the inactivated vaccine is prepared by adopting a newcastle disease virus La Sota strain, an infectious bronchitis virus M41 strain, an avian influenza virus (H9 subtype) YBF003 strain, and an Escherichia coli genetic engineering bacteria E. coil BL21 / pET28a-VP2 strain which expresses an infectious bursal disease virus VP2 protein serving as production bacteria toxic species, a super concentration process and a high-quality adjuvant. After immunizing animals, antibodies are produced rapidly; the potency is high; the protection period is long; and the outbreak and the spreading of epidemic diseases are reduced.

The present invention relates to a special clinical nutritional formula for energy supply during delivery and a preparation method thereof. The special clinical nutritional formula comprises the following components in parts by weight: 1-5 parts of proteins, 0.1-1 part of lipid, 10-15 parts of carbohydrates, 0.05-1 part of dietary fiber, 0.01-0.15 part of macroelement, 0.001-0.004 part of trace element, 0.001-0.003 part of fat-soluble vitamin, 0.01-0.03 part of water-soluble vitamin, 0.01-0.05 part of dietary essence, 0.01-1 part of medicinally and edibly homogenous ingredient, 0.1-0.5 part ofa natural plant compound and 0.01-2 parts of new resource food. The present invention also relates to the preparation method of two clinical nutritional formulas. Through screening and proportioningof the components, the special clinical nutritional formula for the energy supply during the delivery fully supplements needed necessary nutrient components required for the delivery of pregnant women, is more easily digested and absorbed by the pregnant women, fully plays efficacies of the various components, quickly provides the energy required for the delivery of the pregnant women, at the sametime effectively ensures necessary nutrients for fetal growth and development, and helps the pregnant women to conduct the spontaneous delivery and shorten stages of the delivery.

The invention discloses compound grease microcapsules reasonable in fatty acid proportion and high in stability and a preparation method thereof. The compound grease microcapsules are prepared from 30-60 parts of grease, 20-45 parts of carbohydrate, 0-10 parts of protein, 0-10 parts of dietary fiber, 2-5 parts of emulsifier, 0.2-0.5 part of stabilizer and 0.02-0.5 part of antioxidant. A weight ratio of SFA:MUFA:PUFA in the grease is 1:(1.5-2.5):(0.5-1.4), and a weight ratio of n-6 / n-3PUFA in the grease is (4-6):1. The compound grease microcapsules are reasonable in proportion, water solubilityand dispersity of the compound grease microcapsules are improved effectively, and application range of the compound grease microcapsules in food industry is expanded greatly; the compound grease microcapsules have oxidation stability, and shelf life can reach 24 months. The preparation method is simple in process, easy to operate, easy for continuous production and wide in industrialization prospect.

The invention discloses a novel cotton fiber secondary development specific expression gene GhNAC1 full-length sequence, and relates to an important cotton fiber development-associated regulator gene element. The GhNAC1 gene contains three exons and two introns, and is coded with an NAC (N Acetyl L Cysteine) transcription factor. A large quantity of mRNAs (messenger Ribonucleic Acids) of the gene are accumulated specifically at the secondary development stage of the cotton fiber cells, which indicates that the gene is a fiber secondary wall development specific gene. GhNAC1 protein is positioned in a cell nucleolus and has the capability of activating transcription independently, which indicates that the protein serving as a transcription activating factor plays a role in cotton fiber development. GhNAC1 is expressed excessively in arabidopsis, so that leaves crimp upwards, cell walls are thickened, ectopic sedimentation of lignin and the like is detected in foliar epidermic cells, so that the hemicellulose content of foliar cells is greatly increased. As proved by the results, the GhNAC1 can be used for regulating the biosynthesis of cell secondary walls, and plays a key role in the developing process of cotton fiber.

The invention discloses DRD1 protein and an application of agonists of DRD1 protein in preparation of medicine for treating related inflammatory diseases of NLRP3 inflammasome. Under the action of endogenous agonist dopamine, the protein induces degradation of NLRP3 protein which is an important component of inflammasome and has the function of inhibiting maturity and secretion of inflammatory factors such as IL-1 beta and the like, so that activation of NLRP3 inflammasome is inhibited. According to the invention, the application of the DRD1 protein serving as a target point of related inflammatory diseases, such as peripheral nervous system inflammation and central nervous system inflammation, of NLRP3 inflammasome is provided, and the DRD1 protein can be used for screening and developing medicine for the related inflammatory diseases of NLRP3 inflammasome; and the artificially synthesized agonists A-68930, (+ / -)-SKF-38393hydrocholride, SKF89626 and 6-Chloro-PB hydrobromide of the DRD1 protein are further provided and have anti-inflammatory functions, and original ideas and theoretical support are provided for preparation of anti-inflammatory medicine and treatment of the inflammatory diseases by the agonists and active ingredients of the agonists.

The invention discloses a ketogenic-diet composition containing active polysaccharide, and preparation and application methods thereof; the composition is a food prepared through adding dietary fibers and the polysaccharide component having immuno-enhancing activity based on a general ketogenic-diet formula and through combination preparation and supplied for patients to conveniently eat; specifically, the ketogenic-diet composition comprises the used raw material by mass: 1 part of fats, 0.2-1 part of proteins, 0.2-0.4 part of the dietary fibers, and 0.01-0.2 part of the active polysaccharide. The preparation method comprises 5 steps of raw material cleaning, drying, mixing, sterilizing and packaging. The application method comprises that the ketogenic-diet composition is used as a dietary therapy substance to be directly eaten by cancer patients. In the ketogenic-diet composition, the dietary fibers required to be added are cleared up, and the proportion of the dietary fibers and the active polysaccharide is also cleared up; the tumor cells are selectively hungered through ketogenic-diet, physiological ketonemia is generated to regulate a key path of tumor generation and development through ketogenic-diet, and an antitumor action body is generated through ketogenic-diet. The ketogenic-diet composition is suitable for dietary therapy ofor all kinds of cancer patients.

The invention provides an alfalfa leaf protein moistening facial mask. The facial mask is a transparent collagen moistening facial mask and is prepared from the following components in parts by mass: 0.05-5 parts of alfalfa leaf protein serving as a functional raw material, 0.2-10 parts of sodium carboxymethylcellulose, 0.2-10 parts of humectant, 0.05-10 parts of starch and 1-20 parts of a glutaraldehyde crosslinking agent, wherein the sodium carboxymethylcellulose, humectant, starch and glutaraldehyde crosslinking agent are used as auxiliary raw materials. The preparation method comprises the following steps: firstly, extracting alfalfa leaf protein from alfalfa leaves in a fermenting manner; then mixing the alfalfa leaf protein and the auxiliary raw materials; and finally, putting the mixture in a die, heating and forming a film. The alfalfa leaf protein moistening facial mask is mainly prepared from macromolecular substances in natural animal and plant, is non-toxic and odorless, and does not have side effect. The facial mask has the effects of double moistening effect, good toughness, good ductility and good adhesion, and has functions of better skin feeling and deep skin cleaning, thus being an economical, practical and effective skin-care beautifying cosmetic. The facial mask preparation process is simple, is convenient to operate, and does not pollute the environment.

The invention relates to a preparation method for a detection reagent box of a sore mouth disease antibody. According to the method, primary cells of testicles of calves are used, a sixth generation of cell culture fluid obtained through continuous subculturing of sore mouth disease viruses serves as a template for prokaryotic clone, soluble expressed protein is obtained through prokaryotic expression and the detection reagent box of the sore mouth disease antibody is prepared through the expressed protein serving as a coating antigen. Evidences are provided for epidemiological survey of the sore mouth disease according to the analysis and determination of epidemiological characteristics of the sore mouth disease.

The invention discloses an extraction method of rapeseed protein and application of the rapeseed protein to compound feed for Gymnocypris przewalskii. According to the invention, the rapeseed protein of rapeseeds and rapeseed cakes, which serve as raw materials, are separated out by brine, and then are collected, so that anti-nutrients, such as glucosinolate, polyphenol and phytic acid, of the rapeseeds and the rapeseed cakes are removed. The compound feed for the Gymnocypris przewalskii provided by the invention is prepared by compounding the rapeseed protein serving as a raw material and substances such as fish meal, casein, milk powder, meat and bone meal and dry yeast powder, and the compound feed is applicable to all the growth stages, from fish fries to parent fish, of the Gymnocypris przewalskii, so that the source of the raw materials of the compound feed is greatly enriched and the cost of the compound feed is reduced.

The invention belongs to the technical field of transgenic engineering and aims to provide chitinase provided with 2 catalytic domains and having higher activity under the low temperature condition. According to the adopted technical scheme, microbial communities are enriched and cultured in a low temperature environment, metagenomes of the microbial communities are analyzed, a chitinase P1724 gene is cloned, recombinant bacteria are established, P1724 protein is expressed, HIS-TAG is purified, and the properties of recombinant protein serving as the chitinase are identified. The chitinase provided with the 2 catalytic domains is directly obtained for the first time from unseparated microbial strains in the environment through a macroscopic gene method, has better activity under the low temperature condition, has the advantages that the treating time is shorter than the treating time required for medium-high-temperature enzyme, the production cost is low, more energy is saved in application process, is more suitable for industrial production and can have a better application prospect in engineering application.

The invention discloses an ultrahigh permeability bread yeast and a preparation method thereof, and relates to a pattern biological bread yeast, which can be used for detecting environmental genotoxic carcinogen. Through reconstruction of genetic gene technology, the yeast has improved permeability, so that the yeast has wider detection range and higher sensitivity to environmental pollutants. Through gene knock-out technology, genes CWP1 and CWP2, which are used for encoding protein mannose protein serving as an important structure of bread yeast cell wall, is inactivated to improve the permeability of the bread yeast cell wall to environmental carcinogen; and genes SNQ2 and PDR5, which are used for encoding an efflux pump protein on a cell membrane of bread yeast, is inactivated to improve the accumulation of the environmental pollutants in the bread yeast cell. Through the integration of two reconstruction strategies, an RNR3-1acZ system is constructed when four genes CWP1, CWP2, SNQ2 and PDR5 knock out bread microzyme, which can improve the sensitivity of the system to detecting the environmental genotoxic carcinogen.

The invention belongs to the field of biological medicine, relates to a novel brain glioma treatment target, in particular to ribonuclease 4 protein serving as the brain glioma treatment target, further relates to siRNA, shRNA and a neutralizing antibody of the ribonuclease 4 and includes application of the drug prepared from the siRNA, shRNA and the neutralizing antibody and serving as the target to inhibition of growth of brain glioma.The invention discloses application of RNASE4 serving as the drug target to brain glioma inhibition drugs, and the RNASE4 is the ribonuclease 4 and has the amino acid sequence as shown in SEQ ID NO: 1.

The invention provides a luminescence immune detection method based on a recombinant antigen carrying a His tag. His-tag-carried recombinant protein serving as a known antigen, His antibody coating resistant luminescent microspheres, biotin labeled second antibodies and streptavidin labeled light sensing microspheres jointly form a detection reagent. According to the method, the recombinant protein carrying the His tag is taken as the known antigen, the method has the most important characteristic that the known antigen is arranged in liquid-phase three-dimensional space, which is essentially different from an immobilized antigen in the prior art. Due to the change, the technical problems caused by the immobilization process in a traditional antibody detection method are effectively solved. Besides, a homogeneous-phase luminescence immunoassay system based on active oxygen energy transmission is adopted and has higher analysis sensitivity and precision.

The present invention relates to a beef-specific age determination marker containing the p21 protein, to a beef-specific age determination kit containing an antibody which is specifically bound to the p21 protein, and to a method which involves detecting the p21 protein through an antigen-antibody binding reaction using an antibody which is specifically bound to the p21 protein serving as a beef-specific age determination marker in the muscle tissue of beef, so as to determine the age of the beef. According to the present invention, the p21 protein is significantly greatly expressed in the muscle tissue of beef, the age of which is lower than 30 months, and is hardly expressed in the muscle tissue of beef, the age of which is greater than 30 months, and thus can be valuably used as a beef-specific age determination marker.

The invention belongs to the field of biological catalytic synthesis, and particularly relates to a method for improving interfacial catalysis reaction efficiency based on a microcapsule prepared from natural pure protein. The method aims to solve the problems that an existing water-in-oil system is poor in biocompatibility and enzyme stability of pure protein is reduced. The method includes the steps: first, preparing natural pure protein solution; second, preparing oil-in-water microemulsion with natural protein serving as a stabilizer by a Pickering microemulsion method; third, preparing the natural protein microcapsule by taking the microemulsion as a template, and improving the catalysis efficiency of oil-water solution by the aid of catalytic activity of the natural protein. The natural protein serves as the stabilizer, the complicated process of synthesizing the stabilizer is avoided, and efficient oil-water catalysis is realized.

The invention relates to a blocking ELISA antibody detection kit for porcinecircovirus type 2 and a preparation method of the blocking ELISA antibody detection kit. The blocking ELISA antibody detection kit for the porcinecircovirus type 2 comprises a coated plate, a PVC2 enzyme labelled antibody, sample diluent, a concentrated washing solution (10*), a positive serum contrast, a negative serum contrast, TMB substrate diluent and a stop solution, wherein the coated plate is prepared from a purified porcine circovirus type 2 nucleocapsid protein CapC protein serving as a non-antigen, and the PVC2 enzyme labelled antibody is prepared from monoclonal antibody hybridoma which is labeled with horse radish peroxidase and secretes PCV2. According to the preparation method, the CapC protein is expressed by virtue of a prokaryotic expression system, and the blocking ELISA is established by taking a monoclonal antibody of PCV2 as the enzyme labelled antibody; and the blocking ELISA antibody detection kit has the characteristics of high specificity and sensitivity and can be applied to the detection of PCV2 antibodies of a porcine serum sample.

The invention discloses a special type clinical nutrition formula for protecting intestinal mucosal barrier functions damaged after chemotherapy and a preparation method of the special type clinical nutrition formula. The special type clinical nutrition formula comprises the following components in parts by weight of 3-6 parts of fat, 25-45 parts of protein, 10-25 parts of carbohydrate, 12-25 parts of dietary fibers, 0.11-0.3 part of sodium, 0.1-0.2 part of calcium, 0.01-0.02 part of ferrum, 0.01-0.02 part of zinc, 0.01-0.02 part of magnesium, 0.02-0.3 part of composite vitamins, 0.5-5 parts of medical-edible homologous components, 0.1-0.4 part of probiotics, 0.1-1 part of natural plant compounds and 0.1-0.4 part of new resource foods. The clinical nutrition formula provided by the invention is in accordance with patients suffering from damaged intestinal mucosal barriers after chemotherapy, energy supply ratio of the carbohydrate, the protein and the fat is collocated, and multivitamins, minerals, the medical-edible homologous components and the new resource foods are selected, so that clinical symptoms of the patient can be alleviated, water and electrolyte metabolism disorder iscorrected, the nutrient state of the patient is improved, and the special type clinical nutrition formula is safe and free from toxic and side effects.

The invention discloses a special clinical nutrition formula for lactation promoting during a lactation period and a preparation method of the special clinical nutrition formula. The special clinicalnutrition formula is prepared from the following components in parts by weight: 8-15 parts of fat, 25-45 parts of protein, 35-45 parts of carbohydrate, 3-8 parts of dietary fiber, 0.11-0.3 part of sodium, 0.1-0.2 part of potassium, 0.1-0.2 part of calcium, 0.01-0.02 part of iron, 0.01-0.02 part of zinc, 0.01-0.02 part of magnesium, 0.02-0.3 parts of multi-vitamins, 0.5-5 parts of medicine-and-foodhomologous ingredients, 0.1-1 part of a natural plant compound and 0.1-0.4 part of new resource food. According to the clinical nutrition formula for lactation promoting during the lactation period,through reasonable dietary preparation and combined with the energy supply of carbohydrate, the protein and the fat, a variety of vitamins, minerals, the medicine-and-food homologous ingredients and the new foods are selected to provide sufficient breast milk and rich lactation nutrients, lactation promoting is carried out, and the milk is prevented from being blocked.

The invention relates to the field of fermented food processing, in particular to cereal sweet wine, solid-state cereal sweet wine, cereal clear wine and a preparation method thereof. The sweet wine comprises the following components in parts by weight: 100 parts of sticky rice, 20-200 parts of cereal rice, 0.5-2 parts of compound bacteria as well as modulating matters comprising 1-15 parts of white sugar, 1-15 parts of proteins, 1-5 parts of dietary fiber powder, 0.0001-0.003 part of vitamin, 1-25 parts of fruit-vegetable powder, nutrient substances comprising 0.0001-0.0003 part of sodium glutamate and 0.0001-0.002 part of calcium salt. According to the cereal sweet wine and the preparation method thereof, cereal subjected to soaking and sprouting treatment as well as extrusion forming is heated and pasted, and the compound bacteria is added into the cereal for being fermented to prepare the cereal sweet wine. The cereal sweet wine, solid-state cereal sweet wine and cereal clear wine prepared by the preparation method contain live bacteria, are beneficial to improvement on functions of human intestinal tracts and promoting digestive absorption, are good in instant-food property, and are rich in nutrient.

The invention discloses total nutrient formula powder as well as a preparation method and application thereof, and belongs to the field of foods. The total nutrient formula powder specifically comprises the following components in parts by weight: 0.5-3.5 parts of protein, 0.4-2.0 parts of fat, 1.8-6.0 parts of carbohydrate, 0.05-0.5 part of compound vitamins, 0.05-0.5 part of compound minerals, 0.1-1.0 part of dietary fibers and 0.05-1.0 part of probiotics. Through the design, screening and scientific proportioning of raw materials and auxiliary materials, nutrient substances are promoted to be comprehensive and balanced, human body absorption is facilitated, and the total nutrient formula powder is scientific in formula, good in liquidity and reconstituability, convenient to eat, good in taste and the like, can serve as a single nutrient source to meet the nutritional requirements of people with limited feeding, digestion and absorption disorders, metabolic disorders or specific disease states, besides, can promote the digestive system to be healthier, can also be used as a nutritional supplement, and has wide popularization and application market prospects.

The invention provides reproduced coffee cream. The reproduced coffee cream is prepared from the following components in parts by weight: 30-40 parts of anhydrous butter, 0.5-3 parts of protein, 0.1-2parts of an emulsifying agent, 0.01-1 part of a stabilizing agent and 54-68 parts of water. According to the reproduced coffee cream disclosed by the invention, the protein, the emulsifying agent, the stabilizing agent and the water, in an appropriate compounding ratio, are added to the anhydrous butter, so that the reproduced coffee cream is obtained, and the problem of unstable product qualitycaused by seasonal fluctuation of raw milk is solved. Further, anhydrous butter having three different melting points of being high, medium and low is obtained through fractionation on the anhydrous butter, after the obtained anhydrous butter is singly used or combined for cooperation, then the obtained anhydrous butter is compounded with an appropriate amount of the protein, an appropriate quantity of the emulsifying agent, an appropriate quantity of the stabilizing agent and an appropriate amount of the water, and through flexible processing, reproduced coffee cream products having differentcharacteristics are obtained, requirements for different application fields can be met, and the living quality of people is improved.

As an FAM19A4 protein is possibly related to various physiological and pathological conditions and plays an important role in the physiological and pathological conditions, and quantitative detectionof the soluble FAM19A4 protein in specific samples such as blood, body fluid and cell culture supernatant has significance. The invention firstly relates to an application of the FAM19A4 protein serving as a diagnosis marker of a disease including an infectious disease and an autoimmune disease. The invention further relates to a method and kit for quantitatively detecting the soluble FAM19A4 protein. According to the method and kit, the soluble FAM19A4 protein is detected through a micro-sphere solid carrier and a flow cytometry technique by the aid of the double-antibody sandwich method principle, and the method and kit can be used for quantitatively detecting the FAM19A4 protein in body fluids such as serum, plasma, urine, pleuroperitoneal fluids, joint fluids, cerebrospinal fluids, amniotic fluids and follicular fluids of a clinic patient, basic research and various biological samples such as cell culture fluids and mouse blood in a mouse model.

The invention discloses application of FasL protein serving as a biomarker to qualitative Aspirin sensitivity detection of a colorectal cancer stem cell, and further discloses application of mRNA coding the FasL protein and serving as a biomarker to qualitative Aspirin sensitivity detection of the colorectal cancer stem cell, as well as application of acetylated H3K9 protein serving as a biomarker to qualitative Aspirin sensitivity detection of the colorectal cancer stem cell. According to the invention, Aspirin can selectively remove tumor stem cells of colorectal cancer, and can obviously raise the FasL protein expression level in a tumor stem cell of colorectal cancer, so that the FasL protein is Aspirin response protein, the Aspirin sensitivity of the tumor stem cell can be evaluated accurately and fast by detecting the expression level of an FasL gene or the FasL protein in the tumor stem cell. Therefore, Aspirin effectiveness can be evaluated directly from genetic transcription and protein expression / modification level.