Kit for detecting new coronavirus neutralizing antibody and detection method
A coronavirus and kit technology, applied in the field of kits for the detection of new coronavirus neutralizing antibodies, can solve the problems of unsuitable quantitative evaluation, complicated operation, and long detection cycle.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0072] Embodiment 1 recombinant S-RBD-C antigen preparation
[0073] The commercialized 293T cell line was used to transfect and express the recombinant S-RBD-C-hFc antigen with the amino acid sequence shown in SEQ ID No.3, and after culturing in the cell culture box for 48h-96h, the cell culture supernatant was collected and separated. Purification, SDS-PAGE detection protein purity ≥ 90%, protein concentration ≥ 1mg / mL, antigen titer ≥ 1:10000.
[0074] Using the same method to transfect and express the recombinant S-RBD-hFc antigen whose amino acid sequence is shown in SEQ ID No.6 without adding cysteine.
[0075] Shown in SEQ ID No.6:
[0076] MDFGLSLVFLVLILKGVQCRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLE ASEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISR...
Embodiment 2
[0083] Example 2 Preparation of Neutralizing Antibody Detection Card
[0084] 1. Preparation of detection card for novel coronavirus neutralizing antibody by up-transfer luminescent competition method
[0085] 1) Preparation of coated nitrocellulose membrane:
[0086] Coating buffer: 0.01mol / L phosphate buffer, pH7.0-7.5; T line coated with commercially available human recombinant soluble ACE2, purchased from SinoBiological, with a coating concentration of 1.0 mg / mL; C line It is a commercial goat anti-mouse IgG polyclonal antibody (purchased from Invitrogen), and the coating concentration is 1.0 mg / mL. Coat the quality control line and detection line on the nitrocellulose membrane with a fully automatic three-dimensional scribing device, dry at 18-25°C for 30-60min, soak and seal the nitrocellulose with 0.01mol / L PBST buffer solution containing 2% BSA concentration Plain film for 30-60min, dry at 37°C for 30-60min, dry at room temperature and store for later use.
[0087] ...
Embodiment 3
[0099] Example 3 Preparation of Sample Diluent and New Coronavirus Neutralizing Antibody Parameter Card
[0100] 1. The sample diluent is PBS-T buffer solution with pH 7.4, the formula is as follows:
[0101] Potassium dihydrogen phosphate (KH 2 PO 4 ): 0.24g / L;
[0102] Disodium hydrogen phosphate (Na 2 HPO 4 ): 1.44g / L;
[0103] Sodium chloride (NaCl): 8g / L;
[0104] Potassium chloride (KCl): 0.2g / L;
[0105] Tween-20: 0.1%.
[0106] 2. New coronavirus neutralizing antibody parameter card
[0107] The new coronavirus neutralizing antibody parameter card contains kit information such as reagent batch number, production date, expiration date, and standard curve parameters; the standard curve parameters are determined by using the conventional neutralizing antibody titer test method to determine the antibody titer and dilution of the standard sample And it is obtained by comparing and fitting with the detection signal data of the detection signal of the new coronavirus...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


