Sj13 polypeptide, and application thereof in preparation of antithrombus medicine
A kind of use, technology of nucleic acid molecules, applied in the fields of genetic engineering and biomedicine, can solve the problems of no anticoagulant polypeptide reports, weak anticoagulant activity, etc., achieve important development and application value, inhibit thrombus formation, and prolong the effect of detection time
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0049] Example 1: Construction of Schistosoma japonicum polypeptide carrier
[0050] 1. Sj13 PCR primer design
[0051] (1) Through the combination of structural biology and bioinformatics, a new Schistosoma japonicum gene / protein was identified from the Schistosoma japonicum gene / protein library, named Sj13, and its polypeptide amino acid sequence is as follows:
[0052] ETLKRYCNLPSDEGICRGYFRRYFYNVTSGECEVFYYGGLCLGNRNRFSTIEKCWWYCKGL(SEQ ID NO. 1)
[0053] The protein sequence contains 6 cysteines, which can be paired into 3 pairs of disulfide bonds, namely CysⅠ-CysVI, CysⅡ-CysⅣ and CysⅢ-CysⅤ. This pairing method is a typical feature of protein structure.
[0054] (2) Obtain the cDNA sequence of Sj13 through the sequence reverse translation website, as follows:
[0055] gaaaccctgaaacgctattgcaacctgccgagcgatgaaggcatttgccgcggctattttcgccgctatttttataacgtgaccagcggcgaatgcgaagtgttttattatggcggctgcctgggcaaccgcaaccgctttagcaccattgaaaaatgctggtggtattgcaaaggcctg (SEQ ID NO. 2)
[0056] (3)...
Embodiment 2
[0079] Embodiment 2: Expression and purification of Schistosoma japonicum polypeptide
[0080] The constructed pET-28a plasmid was transformed into E.coli Transetta (DE3) expression strains for strain expansion culture to obtain protein inclusion bodies. After the inclusion body was washed, it was denatured, diluted and refolded, concentrated by ultrafiltration and high-performance liquid chromatography (HPLC) to obtain a purified protein solution of the recombinant Schistosoma japonicum protein Sj13. The separation results of high performance liquid chromatography are as follows: figure 2 shown. High performance liquid chromatograph, obvious Sj13 single peak appears, and the protein liquid flowing out under its peak time is all collected, and the purified protein liquid collected is frozen into dry powder with a lyophilizer.
Embodiment 3
[0081] Embodiment 3: BCA quantification of Sj13 protein purification solution
[0082] The BCA protein concentration determination kit (Shanghai Biyuntian Biotechnology Co., Ltd.) was used to quantify the BCA of the purified Sj13 protein solution, and the detected protein concentration was calculated. 10 μg of protein powder was taken out and sent to the Institute of Chemistry, Chinese Academy of Sciences for mass spectrometry detection to further identify whether the protein was recombined successfully. For mass spectrometry results, see image 3 . The mass spectrometry test results provided by the Institute of Chemistry, Chinese Academy of Sciences showed that the molecular weight of the recombinant Sj13 was 9375.3Da; the theoretical molecular weight of Sj13 predicted by the ExPASy-ProtParam tool (http: / / web.expasy.org / protparam / ) website was 9380.52Da. The actual detected value of Sj13 mass spectrometry is consistent with the theoretical value.
PUM
Property | Measurement | Unit |
---|---|---|
Molecular weight | aaaaa | aaaaa |
Theoretical molecular weight | aaaaa | aaaaa |
Molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com