Sj13 polypeptide, and application thereof in preparation of antithrombus medicine

A kind of use, technology of nucleic acid molecules, applied in the fields of genetic engineering and biomedicine, can solve the problems of no anticoagulant polypeptide reports, weak anticoagulant activity, etc., achieve important development and application value, inhibit thrombus formation, and prolong the effect of detection time

Active Publication Date: 2018-09-11
HUBEI UNIVERSITY OF MEDICINE
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Among them, the research on the anticoagulant active substances in Schistosoma mansoni, which is widely prevalent in Africa, South America and Asia, is relatively clear. So far, SmAP, SmPDE, sK1, SmSP, Sm22.6, SHW4-2 and annexin have been found. Anticoagulant proteins, and anticoagulant small molecules such as eicosanoids, but no reports of anticoagulant polypeptides
In 2015, SL Ranasinghe et al. reported the first schistosome anticoagulant polypeptide SjKI-1, which comes from Schistosoma japonicum. SjKI-1 at 7.5 μM can prolong the partial thromboplastin time (APTT) by 2 times and has weak anticoagulant activity , there is no report on the follow-up study of this polypeptide

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Sj13 polypeptide, and application thereof in preparation of antithrombus medicine
  • Sj13 polypeptide, and application thereof in preparation of antithrombus medicine
  • Sj13 polypeptide, and application thereof in preparation of antithrombus medicine

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0049] Example 1: Construction of Schistosoma japonicum polypeptide carrier

[0050] 1. Sj13 PCR primer design

[0051] (1) Through the combination of structural biology and bioinformatics, a new Schistosoma japonicum gene / protein was identified from the Schistosoma japonicum gene / protein library, named Sj13, and its polypeptide amino acid sequence is as follows:

[0052] ETLKRYCNLPSDEGICRGYFRRYFYNVTSGECEVFYYGGLCLGNRNRFSTIEKCWWYCKGL(SEQ ID NO. 1)

[0053] The protein sequence contains 6 cysteines, which can be paired into 3 pairs of disulfide bonds, namely CysⅠ-CysVI, CysⅡ-CysⅣ and CysⅢ-CysⅤ. This pairing method is a typical feature of protein structure.

[0054] (2) Obtain the cDNA sequence of Sj13 through the sequence reverse translation website, as follows:

[0055] gaaaccctgaaacgctattgcaacctgccgagcgatgaaggcatttgccgcggctattttcgccgctatttttataacgtgaccagcggcgaatgcgaagtgttttattatggcggctgcctgggcaaccgcaaccgctttagcaccattgaaaaatgctggtggtattgcaaaggcctg (SEQ ID NO. 2)

[0056] (3)...

Embodiment 2

[0079] Embodiment 2: Expression and purification of Schistosoma japonicum polypeptide

[0080] The constructed pET-28a plasmid was transformed into E.coli Transetta (DE3) expression strains for strain expansion culture to obtain protein inclusion bodies. After the inclusion body was washed, it was denatured, diluted and refolded, concentrated by ultrafiltration and high-performance liquid chromatography (HPLC) to obtain a purified protein solution of the recombinant Schistosoma japonicum protein Sj13. The separation results of high performance liquid chromatography are as follows: figure 2 shown. High performance liquid chromatograph, obvious Sj13 single peak appears, and the protein liquid flowing out under its peak time is all collected, and the purified protein liquid collected is frozen into dry powder with a lyophilizer.

Embodiment 3

[0081] Embodiment 3: BCA quantification of Sj13 protein purification solution

[0082] The BCA protein concentration determination kit (Shanghai Biyuntian Biotechnology Co., Ltd.) was used to quantify the BCA of the purified Sj13 protein solution, and the detected protein concentration was calculated. 10 μg of protein powder was taken out and sent to the Institute of Chemistry, Chinese Academy of Sciences for mass spectrometry detection to further identify whether the protein was recombined successfully. For mass spectrometry results, see image 3 . The mass spectrometry test results provided by the Institute of Chemistry, Chinese Academy of Sciences showed that the molecular weight of the recombinant Sj13 was 9375.3Da; the theoretical molecular weight of Sj13 predicted by the ExPASy-ProtParam tool (http: / / web.expasy.org / protparam / ) website was 9380.52Da. The actual detected value of Sj13 mass spectrometry is consistent with the theoretical value.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Molecular weightaaaaaaaaaa
Theoretical molecular weightaaaaaaaaaa
Molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention discloses a Sj13 polypeptide, sourced from schistosoma japonicum, and a mutant thereof. Through gene engineering technology, a recombinant polypeptide Sj13 and a mutant thereof are obtained; through APTT, PT and TT coagulation function detection, it is identified that the Sj13 and the mutant thereof have excellent in-vitro anti-coagulation function; enzyme kinetics test detection proves that the Sj13 polypeptide and the mutant thereof have functions of inhibiting coagulation related factors XIa, Xa and Plasmin; a mouse FeCl3 damaging common carotid artery thrombus model proves that the Sj13 can inhibit generation of common carotid artery thrombus, has antithrombus effect and is low in bleeding risk. The Sj13 and the mutant thereof have important value of development and application of anti-coagulation and antithrombus medicines.

Description

technical field [0001] The invention belongs to the fields of genetic engineering and biomedicine, and specifically relates to Sj13 polypeptide derived from Schistosoma japonicum and its mutant, and its application in the preparation of anticoagulant and antithrombotic drugs. Background technique [0002] Thrombosis can cause ischemia, hypoxia, necrosis (arterial thrombosis) and congestion, edema (venous thrombosis) of corresponding tissues and organs, which seriously threaten people's life and health. Arterial thrombosis is the main cause of more than 90% of myocardial infarction and 80% of cerebral apoplexy, and arterial thromboembolic cardiovascular and cerebrovascular diseases are the leading cause of human death. Venous thromboembolism (VTE), including deep vein thrombosis (DVT) and pulmonary embolism (PE), is the third leading cause of death from cardiovascular-related diseases after myocardial infarction and stroke. There are millions of VTE patients diagnosed every ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C12N15/12C12N15/11A61K38/17A61P7/02
CPCA61P7/02C07K14/43559A61K38/00Y02A50/30
Inventor陈宗运丁莉罗旭东阮绪芝胡扬根
OwnerHUBEI UNIVERSITY OF MEDICINE