Recombinant human-derived antimicrobial peptide C16LL-37 and application method thereof in streptococcus mutans bioactivity role

A technology of C16LL-37, Streptococcus mutans, applied in the field of bioengineering

Inactive Publication Date: 2016-10-12
NORTHWEST UNIVERSITY FOR NATIONALITIES
View PDF4 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, novispirin G2, as a chemosynthetic antibiotic, has certain cytotoxicity

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Recombinant human-derived antimicrobial peptide C16LL-37 and application method thereof in streptococcus mutans bioactivity role
  • Recombinant human-derived antimicrobial peptide C16LL-37 and application method thereof in streptococcus mutans bioactivity role
  • Recombinant human-derived antimicrobial peptide C16LL-37 and application method thereof in streptococcus mutans bioactivity role

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0075] A recombinant human antimicrobial peptide C16LL-37, synthesized by standard solid-phase synthesis technology, the amino acid sequence of human antimicrobial peptide LL-37 is LLGDFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES and the C-terminal 16 amino acid sequence CSPC16 of Streptococcus mutans CSP is TFFRLFNRSFTQALGK through Linker-GGG-connection, synthetic specific targeting ability of recombinant human-derived antimicrobial peptide C16LL-37 as

[0076] TFFRLFNRSFTQALGK-GGG-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH 2 .

[0077] A preparation method of recombinant human-derived antimicrobial peptide C16LL-37, comprising the steps of:

[0078] A. Resin swelling

[0079] Before use, soak the reaction tube in dichloromethane DCM with a concentration of 7.6ml / g for 5 hours, then weigh 5g of Fomc-Rink-amide-MBHA resin and add it to the reaction tube, and add a concentration of 7.6ml / g along the tube wall 50ml of dichloromethane DCM to make it immerse the resin, after soaking for 2-3h...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
purityaaaaaaaaaa
turbidityaaaaaaaaaa
Login to View More

Abstract

The invention relates to the technical field of biological engineering, relates to a recombinant human-derived antimicrobial peptide C16LL-37 and an application method thereof in streptococcus mutans bioactivity role, and analysis application of antimicrobial activity, targeting property, hemolytic property and other bioactivities of the recombinant antimicrobial peptide C16LL-37. A standard solid-phase synthesis technique is adopted for synthesis, an amino acid sequence of a human-derived antimicrobial peptide LL-37 is connected with 16 amino acid sequences CSPC16 of a C end of streptococcus mutans CSP through connecting body-GGG-connection, and the recombinant human-derived antimicrobial peptide C16LL-37 having specific targeting ability is synthesized. In conclusion, with research and development of the human-derived specifically targeted antimicrobial peptide C16LL-37, not only are the problems that natural antimicrobial peptides have broad antimicrobial spectra, easy generation of drug resistance, low biological efficiency, high difficulty of screening and the like solved, but also the shortcomings that chemically synthesized antimicrobial peptides have low chemical combination efficiency and fusion proteins are unstable are overcome. In addition, an AMP region of the C16LL-37 is derived from a human body, so the C16LL-37 has relatively high biological safety and lays a firm foundation for wide application in clinic in future.

Description

technical field [0001] The invention relates to the technical field of bioengineering, and relates to a recombinant human-derived antibacterial peptide C16LL-37 and its application method on the biological activity of Streptococcus mutans, and the antibacterial activity, targeting and hemolytic properties of the recombinant antibacterial peptide C16LL-37 And other biological activity analysis applications. Background technique [0002] Streptococcus mutans (SM) is the most important pathogenic bacteria of human caries, and inhibiting the proliferation of Streptococcus mutans is of great significance to block the occurrence and development of caries. At present, the anti-caries drugs commonly used in clinical practice, such as chlorhexidine, fluoride preparations, and silver ion preparations, are all chemically synthesized antibiotics with broad-spectrum antibacterial activity. Long-term use will easily lead to adverse consequences such as the increase of drug-resistant strai...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K19/00C07K14/47C07K14/315C07K1/20C07K1/06C07K1/04A61K38/17A61P31/04
CPCA61K38/00C07K14/315C07K14/47C07K2319/00Y02A50/30Y02P20/55
Inventor周建业李志强何祥一车春晓姜科宇张菊梅焦康礼胡晓潘张轩
OwnerNORTHWEST UNIVERSITY FOR NATIONALITIES