Preparation method of water-absorbing and breathable fabric

A breathable and fabric technology, applied in the field of clothing fabrics, can solve the problems of insufficient fabric softness and insufficient wearing comfort, and achieve the effects of soft hand feel, excellent water absorption and breathability, and increased thermal performance.

Active Publication Date: 2018-03-30
宁波博洋家纺集团有限公司
View PDF6 Cites 10 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The fabric has good water absorption and air permeability, and can quickly absorb the moisture attached to the surface of the warp into the fiber, keeping the human body fresh and comfortable, but the fabric is not soft enough, and the wearing comfort is not enough

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Preparation method of water-absorbing and breathable fabric

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0013] A method for making a water-absorbent and air-permeable fabric includes pretreatment of cotton yarn, preparation of modified cotton yarn, and preparation of water-absorbent and air-permeable fabric. The specific steps of the preparation method are:

[0014] 1) Cotton yarn pretreatment: Put the cotton yarn into a detergent solution with a bath ratio of 1:48 and a concentration of 1.1g / L, treat it at 92°C for 36 minutes, then wash it with water, dry it and set aside for later use. The cleaning agent is a mixture of sodium dodecylbenzenesulfonate, Remibang A and antibacterial protein with a weight ratio of 1:0.33:0.022. The amino acid sequence of the antibacterial protein is TDHKLCVYLCRVLHPGKLCVCVNCSKQDNAYASAICHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS. surface, changing the osmotic pressure of the bacteria, and then the active substances inside the bacteria are released, which eventually leads to the death of the bacteria and kills the b...

Embodiment 2

[0018] The manufacturing method of the water-absorbing air-permeable fabric, its specific steps are:

[0019] 1) Cotton yarn pretreatment: Put the cotton yarn into a detergent solution with a bath ratio of 1:53 and a concentration of 0.9g / L, and treat it at 100°C for 20 minutes, then wash it with water, dry it and set it aside for later use. The cleaning agent is a mixture of sodium dodecylbenzenesulfonate, remibang A and antibacterial protein in a weight ratio of 1:0.36:0.02, and the amino acid sequence of the antibacterial protein is TDHKLCVYLCRVLHPGKLCVCVNCSKQDNAYASAICHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS;

[0020] 2) Preparation of modified cotton yarn: put the pretreated cotton yarn into a low-temperature plasma processor, conduct plasma treatment at a power of 160w for 80s, and then immerse the cotton yarn in a post-treatment with a bath ratio of 1:70 In the post-treatment agent, the post-treatment agent is methyltriethoxysilane a...

Embodiment 3

[0023] The production method of the water-absorbent breathable fabric is as follows:

[0024] Put the cotton yarn into a detergent solution with a bath ratio of 1:50 and a concentration of 1g / L, treat it at 96°C for 30 minutes, then wash it with water, dry it and set it aside. : 0.35:0.021 of sodium dodecylbenzenesulfonate, remibang A and antibacterial protein mixture, the amino acid sequence of antibacterial protein is TDHKLCVYLCRVLHPGKLCVCVNCSKQDNAYASAICHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS;

[0025] Put the pretreated cotton yarn into a low-temperature plasma processor, perform plasma treatment for 90s at a power of 150w, then immerse the cotton yarn in a post-treatment agent with a bath ratio of 1:60, and the post-treatment agent is by weight Methyltriethoxysilane and dimethyldiethoxysilane with a ratio of 1:0.023 were post-treated at 100°C for 30 minutes, then the yarn was taken out, washed with absolute ethanol and distilled water...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a preparation method of a water-absorbing and breathable fabric. The specific steps include: putting a cotton yarn into a detergent solution for treatment, and then conductingcleaning and air drying; putting the pretreated cotton yarn into a low temperature plasma processor for plasma treatment, then performing treatment with a post-treatment agent, and conducting cleaningand drying to obtain a modified cotton yarn; taking modified cotton yarn as the warp thread, adopting blended yarn as the weft thread, and performing interweaving to obtain a base cloth, and carryingout heat setting and finishing, thus obtaining the water-absorbing and breathable fabric. According to the invention, the preparation method increases the added value of cotton fiber yarn, has the characteristics of simplicity, convenient operation control, stable quality and high production efficiency, and is easy for large-scale industrial production. The fabric obtained by the method providedby the invention has excellent water absorption and breathability, can make the human body maintain a constant temperature and dry and comfortable state all the time. The fabric can form a unique warmkeeping system, increase the warmth retention properties, and has the advantages of no irritation to skin, soft handfeel, good gloss and strong dyeability.

Description

technical field [0001] The invention relates to the field of clothing fabrics, in particular to a method for preparing water-absorbing and breathable fabrics. Background technique [0002] With the advancement of science and technology and the improvement of people's quality of life, people's consumption concept of clothing has changed to health and comfort, so that the water absorption and breathability of fabrics, as one of the properties of ideal clothing fabrics, has become a common concern of consumers and manufacturers. hotspot. Clothing fabrics with water absorption and breathability should be able to absorb the moisture and sweat emitted by the human body to the greatest extent, and quickly transfer and diffuse them to keep the skin clean and dry, thereby improving the wearing comfort of the clothing. Especially in the climate of high temperature and high humidity in summer, people will sweat a lot during strenuous exercise, which makes it difficult for the sweat on...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): D06M15/15D06M10/08D06M15/564D06M13/148D06M15/53D06M15/09C11D1/37C11D3/37C11D3/48D03D13/00D03D15/00D06M101/06D03D15/217D03D15/225D03D15/283D03D15/30D03D15/47D03D15/50D03D15/52D03D15/527
CPCC11D1/37C11D3/3719C11D3/48D03D13/00D03D15/00D06M10/08D06M13/148D06M15/09D06M15/15D06M15/53D06M15/564C11D1/10C11D1/22D06M2101/06D06M2200/20D06M2200/12D10B2201/02D10B2331/04D10B2401/062D10B2401/14D10B2401/022D10B2401/04D10B2401/20
Inventor杨艳叶力
Owner宁波博洋家纺集团有限公司