Fusion protein and method for preparing liraglutide intermediate polypeptide

A fusion protein and intermediate technology, which is applied in the field of genetic engineering and polypeptide preparation, can solve the problems of long dissolution and renaturation time of inclusion bodies, unsuitable for large-scale production, large renaturation volume, etc., and is conducive to industrial scale-up , Reduce the renaturation process and reduce the effect of the enzyme digestion system

Active Publication Date: 2019-08-16
AMPHASTAR NANJING PHARMA +1
View PDF5 Cites 13 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The above-mentioned fusion protein obtains high-yield and high-purity polypeptide GLP-1 (7-37) through operations such as dissolution, renaturation, enzyme digestion, and separation, which solves the problems of many impurities, low yield, and use in the prior art. A large number of organic reagents are not friendly to the environment, soluble expression in cells leads to low expression, inclusion body dissolution and renaturation time are long, and low protein concentration leads to too large renaturation volume, which is not suitable for large-scale production and limits the possibility of increasing production capacity. question

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Fusion protein and method for preparing liraglutide intermediate polypeptide
  • Fusion protein and method for preparing liraglutide intermediate polypeptide
  • Fusion protein and method for preparing liraglutide intermediate polypeptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0061] The construction of embodiment 1 recombinant engineering bacterium

[0062] Design of a fusion protein sequence to the propeptide of liraglutide for expression in E. coli. The N-terminal leader peptide sequence can enhance expression and protect the liraglutide propeptide fusion protein from being degraded by Escherichia coli. A preferred leader peptide sequence is MATHAVSVLKGDGPVQGIINFEQHESNGPVKVWGSIHGLTEGLHGFHVHKFVNQHLCGSHLVALYLV (SEQ ID NO. 3). The C-terminus of the leader peptide sequence is connected to the liraglutide propeptide through DDDDK residues, and the leader peptide is removed by enzymatic digestion with enterokinase. Therefore, the full sequence of the fusion protein Leading Peptide-DDDDK-GLP-1 (7-37) with the leading peptide SEQ ID NO.3 is SEQ ID NO.9, and the specific sequence is as follows:

[0063] MATHAVSVLKGDGPVQGIINFEQHESNGPVKVWGSIHGLTEGLHGFHVHKFVNQHLCGSHLVALYLVDDDDKHAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG;

[0064] The gene fragment of the above-mentio...

Embodiment 2

[0065] The construction of embodiment 2 recombinant engineering bacteria

[0066] Refer to the same method as in Example 1 to design the full sequence of the fusion protein LeadingPeptide-DDDDK-GLP-1 (7-37) comprising the leading peptide SEQ ID NO.4.

[0067] The gene of the above-mentioned Leading Peptide-DDDDK-GLP-1(7-37) fusion protein was synthesized by conventional fusion PCR technology, and the obtained sequence cDNA was inserted into the plasmid pET-24a(+ ) in the corresponding restriction site, the constructed recombinant plasmid is as follows figure 2 As shown, the recombinant plasmid inserted into the gene encoding the fusion protein of Leading Peptide-DDDDK-GLP-1 (7-37) was transformed into the host Escherichia coli HMS174 (DE3) by conventional genetic engineering techniques.

Embodiment 3

[0068] The construction of embodiment 3 recombinant engineering bacteria

[0069] Referring to the same method as in Example 1, the full sequence of the fusion protein LeadingPeptide-DDDDK-GLP-1 (7-37) comprising the leading peptide SEQ ID NO.5 was sequentially designed.

[0070] The gene of the above-mentioned Leading Peptide-DDDDK-GLP-1 (7-37) fusion protein was synthesized by conventional fusion PCR technology, and the obtained sequence cDNA was inserted into the plasmid pET-29a (+ ) into the corresponding restriction site, and insert the recombinant plasmid encoding the Leading Peptide-DDDDK-GLP-1 (7-37) fusion protein gene into the host Escherichia coli JM109 (DE3) by conventional genetic engineering techniques.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
purityaaaaaaaaaa
Login to View More

Abstract

The invention belongs to the technical field of polypeptide preparation, and in particular, relates to a fusion protein and a method for preparing a liraglutide intermediate polypeptide GLP-1 (7-37).The method includes the main steps: constructing recombinant liraglutide intermediate engineering bacteria, expressing a GLP-1 (7-37) fusion protein by culture and induction of escherichia coli, and carrying out denaturation, renaturation, enzyme digestion and separated purification to obtain the intermediate polypeptide GLP-1 (7-37). Through changing a sequence of leading peptide, the expressionmode becomes an intracellular insoluble inclusion body expression, and the expression quantity is remarkably increased; inclusion bodies after washing are dissolved at high pH, and a large amount of denaturants are not needed to use, the inclusion bodies after washing are added to a inclusion body dissolved buffer solution at a high protein concentration of 5-40 g / L, the renaturation time does notexceed 1 h, and enterokinase digestion is carried out immediately after dissolution; the renaturation process can be reduced, the enzymatic digestion system is reduced, the cost of chemical reagentscan be reduced, and industrial amplification is facilitated; ion exchange separation and purification can be used, and the separation degree is high. The prepared liraglutide intermediate polypeptideGLP-1 (7-37) reaches 92% or more and the yield is more than 87%.

Description

technical field [0001] The invention relates to the technical field of genetic engineering and polypeptide preparation methods, in particular to a fusion protein and a method for preparing a liraglutide intermediate polypeptide. Background technique [0002] Diabetes mellitus is due to the interaction of genetic and environmental factors, resulting in the absolute or relative insufficiency of insulin secretion and the decrease in the sensitivity of target tissue cells to insulin, causing a series of metabolic disorder syndromes such as protein, fat, water and electrolytes, among which hyperglycemia is the main symbol . In typical clinical cases, symptoms such as polyuria, polydipsia, polyphagia, and weight loss may appear, that is, symptoms of "three excesses and one deficiency". In recent years, with the improvement of living standards, changes in diet structure, most people move less and sit more, and other factors have led to a rapid increase in the incidence of diabetes...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K19/00C12N15/62C12N15/70C12N1/21C12R1/19
CPCC07K7/06C07K14/605C07K2319/00C12N15/70
Inventor潘尚书汤传根李宬刘晓锐崔怀言陈松张昊宁
OwnerAMPHASTAR NANJING PHARMA