Cell adhesion molecule 5 monoclonal antibody, preparation method and applications thereof
A monoclonal antibody and adhesion molecule technology, applied in biochemical equipment and methods, receptors/cell surface antigens/cell surface determinants, microbial-based methods, etc., can solve unstable test results, low activity, impact In-depth development of experimental research and other issues to achieve the effect of less antibody usage, high titer, and high expression
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1I
[0028] Embodiment 1 ICAM5 monoclonal antibody preparation
[0029] 1. Polypeptide antigen synthesis
[0030] From the human ICAM5 protein sequence, the second immunoglobulin-like region of cell adhesion molecule 1 (Ig2-ICAM-1-like, ICAM1-CD54) intermittently selects 6 amino acid sequences for peptide synthesis (amino acids 30-220). The peptide synthesis was completed by Abimate Biomedicine (Shanghai) Co., Ltd. The sequence of the 6 peptides is as follows:
[0031] RCARRT\LQARARGLIRT\FQRGLRWLARQL\VRASLTLTLLRTSLR\RNGTQRLQPRVAFV\ERRRSFAGEPPR, molecular weight 34KD, purity >90%.
[0032] The synthetic polypeptide sequence is shown as SEQ ID No.1:
[0033] RCARRTLQARARGLIRTFQRGLRWLARQLVRASLTLTLLRTSLRRNGTQRLQPRVAFVERRRSFAGEPPR
[0034] 2. Animal immunization
[0035] Three healthy female BALB / C mice aged 8-12 weeks were immunized with the synthesized polypeptide antigen. Take the rapid immunization method of mice.
[0036] Initial immunization: Antigen 50ug / body, plus Freund's...
Embodiment 2
[0112] Example 2 Application of ICAM5 Monoclonal Antibody in Immunofluorescence Experiment
[0113] Immunofluorescence Detection of ICAM5 on Cell Surface of Primary Cultured Neurons in Mouse Cerebral Cortex
[0114] Animal experiments were carried out in strict accordance with the relevant regulations on the protection of experimental animals. Fetal mouse brain tissue was collected after 16 days of pregnancy, and placed in dissecting separation solution (1 × Hanks balanced salt solution + 2.5mmol / L Hepes + 30mmol / L D-glucose + 2mmol / L CaCl) under an optical microscope 2 +0.5mmol / L MgSO 4 +2mmol / L NaHCO3+0.03%BSA+1% penicillin and streptomycin) to remove the dura mater and separate the cerebral cortex. After washing twice with the dissection separation solution, pipette gently to make the cortical tissue become a single suspended neuron cell. After filtering with a 200-mesh screen, centrifuge at 1500r / min (centrifugal radius: 10cm) for 3min, discard the supernatant, and add ...
Embodiment 3I
[0116] Example 3 Application of ICAM5 monoclonal antibody in Western blotting
[0117] Western blotting detection of ICAM5 protein in human brain tissue samples
[0118] Take the autopsy specimens of AIDS brain tissue frozen at -135 ℃, and extract tissue protein by high-salt lysis method. The specific steps are as follows: use small scissors to cut off tissue pieces about the size of mung bean grains, cut them as much as possible with scissors, and add 500 μl of ice-cold 1× PBS is homogenized with a homogenizer (note that the above operations are required to be on ice, and protease inhibitors should be added to PBS according to the concentration). After homogenization, pour the tissue homogenate into a clean Ep tube, Add ice-cold 2× high-salt lysate (1%NP40, 0.1%SDS, 0.04% sodium deoxycholate, 150mMNaCl, 50mMpH8.0Tris-HCl, 5mMEDTA, add 1:1000PMSF when used), place on ice for 20 minutes for complete lysis. After centrifugation at 4°C for 20 minutes, the supernatant was collec...
PUM
![No PUM](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/noPUMSmall.5c5f49c7.png)
Abstract
Description
Claims
Application Information
![application no application](https://static-eureka.patsnap.com/ssr/23.2.0/_nuxt/application.06fe782c.png)
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com