Hyphantria cunea cecropin A gene as well as expression protein and application thereof
A technology of American white moth and cecropin, applied in the field of genetic engineering, can solve the problem of not being cloned, and achieve the effect of strong antibacterial activity and wide application prospect.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0017] Example 1 Cloning of Cecropin A cDNA
[0018] 1. Extract the total RNA of white moth.
[0019] Use RNA extraction reagent (TIANGEN) to extract the total RNA of fat body of white moth pupae according to its operation manual, and identify its purity by formaldehyde-denatured agarose gel electrophoresis, which is greater than 95%, and its concentration is 720 ng as determined by ultraviolet spectrophotometer / μL, to meet the needs of use.
[0020] 2. Use Transgen cDNA reverse transcription kit to transcribe into first-strand cDNA.
[0021] 1) Primer design: According to the sequence alignment of Cecropin A in NCBI, Bombyx mori and Drosophila, degenerate primers were designed:
[0022] Cec-A1: 5'-ATGAATTTCNCAANAATNNNTNTNCTTCGT-3',
[0023] Cec-A2: 5'-NTATTTNCNAANGNTTTTTNCNGTACCCAG-3'.
[0024] 2) Reverse transcription: Add 3 μL of total RNA extract, Oligo d(T) to DEPC-treated 1.5mL Eppendorf tubes sequentially 18 (0.5 μg / μL) 1 μL, 2×TS Reaction Mix 10 μL, DEPC water 5 ...
Embodiment 2
[0027] According to the cecropin A protein sequence obtained in Example 1, the polypeptide sequence (N-terminal-C-terminal) of the cecropin A antimicrobial peptide of the American white worm was synthesized in vitro: RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK, the main specific process is as follows:
[0028] First, an amino acid whose amino group is protected by a blocking group is covalently linked to a solid support. Under the action of trifluoroacetic acid, the protective group of the amino group is removed, so that the first amino acid is connected to the solid phase carrier. Then the carboxyl group of the second amino acid whose amino group is blocked is activated by N,N'-dicyclohexylcarbodiimide (DCC, Dicyclohexylcarbodiimide), and the carboxyl group is activated by DCC. Amino groups of two amino acids react to form peptide bonds, thus generating a dipeptide with a protecting group on the solid support.
[0029] Repeat the above peptide bond formation reaction to make the p...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 