Extraction method of spirulina phycocyanin

A technology of phycocyanin and extraction method, which is applied in the field of extraction of spirulina phycocyanin, can solve the problems of loss of fluorescence characteristics, unsatisfactory wall breaking effect, unfavorable protein yield, etc., achieve low production cost and improve body immunity The effect of simple function and extraction process

Inactive Publication Date: 2017-10-27
浦江县欧立生物技术有限公司
View PDF4 Cites 11 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The phycocyanin crude extract prepared by the invention can be stored for a long time, and the phycocyanin finished product prepared by further purification has good antioxidant free radical scavenging effect and fluorescence intensity, but the wall breaking effect in the extraction process of the phycocyanin is not good. It is too ideal, which is not conducive to improving the yield of protein. This extraction method is easy to lose the fluorescent properties of phycocyanin with fluorescent properties during the long-term extraction process.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0014] A method for extracting spirulina phycocyanin, comprising: crushing crude cells, salting out, two-phase extraction, and ultrafiltration, and the specific operation steps are as follows:

[0015] (1) Crude cell crushing: prepare spirulina extract, solid-liquid ratio (m(g):V(mL) ) =1:150, add 0.08% functional protein peptide of spirulina dry powder weight, add 25mM sodium phosphate buffer solution (pH7.0), repeated freezing and thawing at -20°C and 37°C for 5 times, each time for 4 hours, centrifuged the broken wall solution after freezing and thawing 5 times at 5000rpm for 30min, collected the supernatant to obtain algae The crude extract of blue protein was stored in a 4°C refrigerator for later use. The amino acid sequence of the functional protein peptide was MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGRGLCRRFCYAEYFVGHHCPRRYRCCAIRA;

[0016] (2) The salting-out step is: add (NH 4 ) 2 SO 4 When the solution reaches 80% saturation, let stand at 3°C ​​for 12 hours, and centrifuge t...

Embodiment 2

[0020] A method for extracting spirulina phycocyanin, comprising: crushing crude cells, salting out, two-phase extraction, and ultrafiltration, and the specific operation steps are as follows:

[0021] (1) Crude cell crushing: prepare spirulina extract, solid-liquid ratio (m(g):V(mL) ) =1:150, add 0.10% functional protein peptide of spirulina dry powder weight, add 25mM sodium phosphate buffer solution (pH7.0), repeated freezing and thawing four times at -20°C and 37°C, each time for 4 hours, centrifuged the broken wall liquid after freezing and thawing four times at 5000rpm for 30min, collected the supernatant to obtain algae The crude extract of cyanin was stored in a 4°C refrigerator for later use. The amino acid sequence of the functional protein peptide was MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGRGLCRRFCYAEYFVGHHCPRRYRCCAIRA. The active peptide is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water, and the lipophilicity makes it combine with the cel...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an extraction method of spirulina phycocyanin. The extraction method comprises the following steps: crude cell disruption, salting out, double-aqueous phase extraction and ultrafiltration, and is characterized in that the cell disruption step comprises the following steps: adding functional protein peptide in algae liquid, selecting a sodium phosphate buffer solution as an extraction solvent, and carrying out repeated freezing and thawing and centrifugation to obtain supernate as a crude protein extract. By adopting the extraction method, the problem of low protein extraction rate caused by low sporoderm-broken rate in the prior art is solved; the phycocyanin extracted by the extraction method provided by the invention can improve the activity of lymphocytes, comprehensively strengthens the disease prevention ability and the disease resistance ability of an organism by improving the organism immune function by a lymphatic system, also has excellent functions of oxidation resistance, radiation resistance, anti-inflammation and bacterium inhibition, and can be used in the field of feed or beverages. The extraction process of the spirulina phycocyanin is simple, is strong in operability and low in production cost, and can be used for producing the spirulina phycocyanin in batch.

Description

technical field [0001] The invention belongs to the technical field of natural product protein extraction, in particular to a method for extracting spirulina phycocyanin. Background technique [0002] Spirulina (Spirulina) is a class of multicellular, non-helical, filamentous and spiral-shaped prokaryotes distributed in freshwater or saline-alkali lakes in tropical and subtropical regions, also known as cyanobacteria. The phycobiliprotein in Spirulina is An important light-harvesting pigment protein, composed of phycocyanin and allophycocyanin, the absorbed light energy is transmitted from phycocyanin to allophycocyanin, and then transmitted to the photosynthetic reaction center by allophycocyanin. It has been shown that phycocyanin can increase the activity of lymphocytes, improve the body's immune function through the lymphatic system, and comprehensively enhance the body's ability to prevent and resist diseases. [0003] At present, the separation and purification of spi...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K14/795C07K1/34C07K1/30C07K1/14
Inventor李冰
Owner浦江县欧立生物技术有限公司