Extraction method of spirulina phycocyanin
A technology of phycocyanin and extraction method, which is applied in the field of extraction of spirulina phycocyanin, can solve the problems of loss of fluorescence characteristics, unsatisfactory wall breaking effect, unfavorable protein yield, etc., achieve low production cost and improve body immunity The effect of simple function and extraction process
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0014] A method for extracting spirulina phycocyanin, comprising: crushing crude cells, salting out, two-phase extraction, and ultrafiltration, and the specific operation steps are as follows:
[0015] (1) Crude cell crushing: prepare spirulina extract, solid-liquid ratio (m(g):V(mL) ) =1:150, add 0.08% functional protein peptide of spirulina dry powder weight, add 25mM sodium phosphate buffer solution (pH7.0), repeated freezing and thawing at -20°C and 37°C for 5 times, each time for 4 hours, centrifuged the broken wall solution after freezing and thawing 5 times at 5000rpm for 30min, collected the supernatant to obtain algae The crude extract of blue protein was stored in a 4°C refrigerator for later use. The amino acid sequence of the functional protein peptide was MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGRGLCRRFCYAEYFVGHHCPRRYRCCAIRA;
[0016] (2) The salting-out step is: add (NH 4 ) 2 SO 4 When the solution reaches 80% saturation, let stand at 3°C for 12 hours, and centrifuge t...
Embodiment 2
[0020] A method for extracting spirulina phycocyanin, comprising: crushing crude cells, salting out, two-phase extraction, and ultrafiltration, and the specific operation steps are as follows:
[0021] (1) Crude cell crushing: prepare spirulina extract, solid-liquid ratio (m(g):V(mL) ) =1:150, add 0.10% functional protein peptide of spirulina dry powder weight, add 25mM sodium phosphate buffer solution (pH7.0), repeated freezing and thawing four times at -20°C and 37°C, each time for 4 hours, centrifuged the broken wall liquid after freezing and thawing four times at 5000rpm for 30min, collected the supernatant to obtain algae The crude extract of cyanin was stored in a 4°C refrigerator for later use. The amino acid sequence of the functional protein peptide was MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGRGLCRRFCYAEYFVGHHCPRRYRCCAIRA. The active peptide is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water, and the lipophilicity makes it combine with the cel...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap