Application of hybrid antibacterial peptide as the feed supplement
A technology of hybrid antibacterial peptides and feed additives, applied in the biological field, can solve problems such as restricted use, and achieve the effects of increasing resistance, wide application range and strong hemolysis
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0016] (1) Design of antimicrobial peptides
[0017] According to the primary structure of melittin: GIGAVLKVLTTGLPALISWIKRKRQQ and the primary structure of melittin: GSKKPVPIIYCNRRTGKCQRM, a new antimicrobial peptide was designed: the N-terminus is amino acids 12-26 of melittin, and mutated into GLPLLISWIKRKRQQ9 (amino acids in italics are mutated amino acids) ; The C-terminus is a complete death protein, after connecting with AGP in the middle, the primary structure of the designed antimicrobial peptide is GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM (amino acid abbreviation rules: glycine G, serine S, alanine A, threonine T , valine V, isoleucine I, leucine L, tyrosine Y, phenylalanine F, histidine H, proline P, aspartic acid D, methionine M, Glutamate E, Tryptophan W, Lysine K, Cysteine C, Arginine R).
[0018] (2) Construction of recombinant expression vector
[0019] See the build process figure 1 .
[0020] 1) Design the three-segment primer of the primer:
[0021]...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com