Application of hybrid antibacterial peptide as the feed supplement

Abstract

The invention belongs to the biotechnological field, and particularly relates to a technique for preparing a feed supplement through gene recombination of designed antibacterial peptide in yeast. The application of hybrid antibacterial peptide as the feed supplement is characterized by comprising the following steps: performing gene recombination of the hybrid antibacterial peptide onto a pRHZ-41L carrier, wherein the hybrid antibacterial peptide adopts a primary structure of GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM; transforming the recombinant carrier into S. pombe; cultivating on an MAA solid medium for 5 days; picking single colony from the solid medium to be inoculated onto a liquid EMM culture medium for cultivation for 3 days; cultivating engineering bacteria in an enlarged scope; filtering out the culture medium after large scale fermentation of the engineering bacteria, and adding into feed or drinking water after drying. According to the invention, the S.pombe can be directly used for expressing the antibacterial peptide, and then directly for preparing the feed supplement, so that the protein separation and purification process can be omitted, and accordingly, the production cost is reduced, the livestock resistibility is increased, and the use of antibiotics is reduced.

Description

technical field [0001] The invention belongs to the field of biotechnology, in particular to the technology of recombining designed antibacterial peptide genes in yeast to prepare feed additives. Background technique [0002] Antibacterial peptides (antibacterial peptides) are a class of peptides with a small molecular weight, most of them are composed of 13-45 amino acids, some antibacterial peptides are all composed of L-amino acids, and some antibacterial peptide molecules contain both L-amino acids and D -Amino acid, the molecular weight is generally several thousand Daltons, often positively charged, in 1980, Hultmark et al. first isolated a cecropin from the pupa of Hyatophoracecropia, and named it cecropin. Antibacterial peptides have antibacterial, antiviral, antitumor and other activities, good water solubility, and high temperature resistance. Moreover, antimicrobial peptides are generally small peptides, which can be completely digested by animals, and there is n...

AI Technical Summary

Problems solved by technology

[0004]Melittin is the main active ingredient of Italian bee (Apismellifera) venom, an antibacterial peptide isolated from bee venom by Habermanm et al. , anti-inflammatory, anti-radiation, anti-arthritis, anti-tumor, anti-AIDS, and cardiovascular effects, especially against Staphylococcus aureus, but melittin has strong hemolytic properties, which limits further clinical use

Images