42results about How to "Eliminate separation and purification" patented technology

The invention belongs to the technical field of organisms, and particularly relates to a preparation method of L-tyrosine or L-tyrosine derivative (L-3-hydroxy tyrosine) employing enzyme conversion. The preparation method comprises the steps of: adopting feed liquid containing pyruvic acid as a substrate; adding bacterial cells with tyrosine phenol lyase activity, or crude enzyme, ammonia water, phenol or pyrocatechol; carrying out enzymatic reaction under the conditions that the temperature is 25-55 DEG C and the pH is 7-11; and separately preparing a converted product L-tyrosine or L-dioxyphenylalanine by using an isoelectric point crystallization method. By adopting the method, the L-tyrosine or L-dioxyphenylalanine with high additional value is synthetized by using cheap pyruvic acid liquid as the substrate by an enzymic method; the preparation method has the advantages of being wide in material source, high in enzymatic conversion efficiency, simple and convenient to operate, low in production cost and the like.

The present invention relates to a method used for synthesizing derivatives of 1-alkyl-2-alkoxy-3-indole aldehyde oxime. Indole-one is used as basic material and treated through Vilsmeier-Hacck formylation reaction and alkylation reaction to prepare 1-alkyl-2-chlorine-3-indole aldehyde; under the conditions with potassium hydroxide and fatty alcohol and at the temperature of 50 to 80 DEG C, the reaction is monitored by a thin chromatogram TLC; after the reaction is completed, no treatment is required and hydroxylamine hydrochloride is directly added into the mixture for oximation reaction; the reaction temperature is maintained; the reaction lasts for 1 to 2 hours; the ratio of the 1-alkyl-2-chlorine-3-indole aldehyde, the hydroxylamine hydrochloride, the potassium hydroxide, the fatty alcohol and water is equal to 1mmol to 2mmol to 2mmol to from 5ml to 8 ml to 1ml; finally water is added for sedimentation, and the novel compounds of the category of the 1-alkyl-2-chlorine-3-indole aldehyde can be separated through filtration and chromatography. The method has the advantages of mild reaction conditions, process under atmospheric pressure, simple operation, less investment in the equipment, low production costs, less pollution and high yield.

The invention belongs to the biotechnological field, and particularly relates to a technique for preparing a feed supplement through gene recombination of designed antibacterial peptide in yeast. The application of hybrid antibacterial peptide as the feed supplement is characterized by comprising the following steps: performing gene recombination of the hybrid antibacterial peptide onto a pRHZ-41L carrier, wherein the hybrid antibacterial peptide adopts a primary structure of GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM; transforming the recombinant carrier into S. pombe; cultivating on an MAA solid medium for 5 days; picking single colony from the solid medium to be inoculated onto a liquid EMM culture medium for cultivation for 3 days; cultivating engineering bacteria in an enlarged scope; filtering out the culture medium after large scale fermentation of the engineering bacteria, and adding into feed or drinking water after drying. According to the invention, the S.pombe can be directly used for expressing the antibacterial peptide, and then directly for preparing the feed supplement, so that the protein separation and purification process can be omitted, and accordingly, the production cost is reduced, the livestock resistibility is increased, and the use of antibiotics is reduced.

The invention relates to a method for production of o-xylene from coal based raw materials. The method adopts cheap coal based crude benzene and coal based crude methanol as the raw materials, employs a weak acid and medium strong acid based alkylation catalyst with large surface area and an anti-coking alkylation reaction medium, and carries out pickling, hydropretreating, alkylation reaction, rectification, isomerization reaction, and transalkylation reaction for high selectivity production of o-xylene; optionally, the method further comprises toluene disproportionation reaction. The alkylation reaction is carried out in a fixed bed, fluidized bed or moving bed reactor, the catalyst is a two-metal oxide modified flake MCM-56, nano acicular ZSM-5, flake MCM-49 or nano Beta molecular sieve, or a compound thereof; the isomerization, transalkylation and disproportionation reactions also use the novel special catalyst, and are all carried out in a fixed bed reactor. The method provided by the invention can effectively reduce the production cost of o-xylene, and completely realizes non-petroleum route production thereof.

The invention discloses a method for synthesizing gallic acid propyl ester in organic phase by microbe method. The method comprises the following steps: 1) collecting and filtering the mycelia cultured from aspergillus niger spores; 2) flushing with 0.85% (w/v) NaCl solution, balancing in 0.01~0.02mol/L pH 2.2~5.8 buffer solution and filtering to obtain the mycelia containing 60~80% (w/w) water; 2) in organic solvent benzene system, charging 0.06~0.1L normal propyl alcohol and 4~10mmol gallic acid into each liter organic solvent, then charging 20~50g said aspergillus niger mycelia into each liter organic solvent, implementing the biological catalytic reaction with the 150~220rpm stirring speed and under the temperature of 20~50íµ for 48~96 hours. The invention establishes the fermentation culture medium for the tannases of aspergillus niger, omits the separation and purification of the enzyme and lower the production cost by using the aspergillus niger as the biological catalyst instead of traditional free enzymes or fixed enzymes.

The invention belongs to the technical field of functional polymer membrane separation, and relates to a method for preparing a crown-ether graft polymer micro-porous membrane with a reaction-solution phase inversion control method. The method includes the steps that a chloromethyl-containing polymer such as polysulfone or polyether sulfone or polyether ether ketone is dissolved into a reaction solvent, an active-amido containing crown ether compound such as 4-aminobenzene-15-crown-5 is added, and a crown ether graft polymer is prepared through a nucleophilic substitution reaction between chloromethyl and amino; the grafting ratio of the reaction is controlled; in other words, when a reaction system is in certain viscosity, the reaction is terminated to prevent gelatinizing, the reaction system at the moment serves as a membrane casting solution, and the crown-ether graft polymer micro-porous membrane is prepared with the solution phase inversion method. As a cross bond exists in the polymer system, it can be achieved that the polymer micro-porous membrane which is high in porosity ratio and breaking strength is prepared under the low solid content of the polyether, and the separation step and the purification step of the grafted polymer are omitted; as a crown ether group exists, the polymer membrane has excellent lithium isotope separation performance.

The invention provides a preparation method of 2-methylamino-5-t-butyl-1,3,4-thiadiazole. Pivalic acid directly used as a raw material reacts with methylthiosemicarbazide with solid phosgene or a phosgene dimer or phosgene as an acylation reagent and a cyclization reagent to synthesize 2-methylamino-5-t-butyl-1,3,4-thiadiazole. The preparation method allows highly pure 2-methylamino-5-t-butyl-1,3,4-thiadiazol to be prepared, has the advantages of very high yield, safe operation, very low production cost, solving of the defects of existing production technologies, environmental protection and no pollution.

The invention relates to a preparation method of polyphosphoester. According to the method, phosphorus oxychloride, dialkyl phenol and hydroquinone are prepared into polyphosphoester through a one-step method, and finally the polyphosphoester is terminated by using phenol. The method includes the steps that the phosphorus oxychloride and the dialkyl phenol are used for generating monomer monophenyl ester, then polymerization is conducted through the hydroquinone to obtain a poly-phospholipid intermediate, and the intermediate is terminated by using phenol. The polymerization degree is 1-20. The method is carried out at normal pressure according to synthesis conditions, the process is simple, the safety coefficient is high, and the polyphosphoester is wide in application range, can serve asa solid flame retardant, has the advantages of being resistant to volatilization, migration and radiation, high in heat resistance, good in compatibility, low in toxicity and durable in flame retardant effect, can serve as a plasticizer for materials, and has the advantages of being high in toughness, small in brittleness and capable of improving the mechanical properties such as material notch impact strength.

The invention belongs to the technical field of chemical engineering, and particularly relates to a method using neutralizing wastewater in BHT (butylated hydroxytoluene) production to produce sodiump-toluenesulfonate. The neutralizing wastewater comprises sodium p-toluenesulfonate and an alkaline neutralizing agent. The method comprises the following steps of step 1, adjusting the pH (potentialof hydrogen) value of the produced neutralizing wastewater in BHT production process to 6 to 7; step 2, discoloring the neutralizing wastewater with adjusted pH value by an adsorbent; step 3, filtering the discolored neutralizing wastewater, evaporating and concentrating, cooling, and crystallizing, so as to obtain a crude product of the sodium p-toluenesulfonate. The method has the advantages that the wastewater of the BHT technology can be eliminated, the difficult problem of environment protection is solved, the wastewater can be recycled as resource, the production cost of the sodium p-toluenesulfonate is reduced, and the economic benefit is increased.

The invention relates to a method for rapidly determining the content of phenol in wastewater by purge and trap-gas chromatography-mass spectrometry, which comprises the following steps: 1) collecting a wastewater sample, adding phosphoric acid, and adjusting the pH value of the wastewater sample to weak acidity; (2) purging phenol in the wastewater sample by using a purging and trapping sample injector, trapping the phenol by using a trapping trap, and then analyzing the phenol to enter a gas chromatograph-mass spectrometer; and (3) carrying out qualitative and quantitative analysis on the phenol trapped by the trapping trap by using a gas chromatograph-mass spectrometer. Compared with the prior art, the method for measuring the phenol content in the industrial wastewater is simple, rapid, efficient and accurate, the wastewater with complex components and high organic matter concentration can be directly purged, the pretreatment processes such as separation and purification are omitted, an organic solvent is not needed for extraction, the detection cost is reduced, and the method is suitable for large-scale popularization and application. The time for detecting a group of water samples is shortened from two hours to about 30 minutes, and the detection limit is 0.01-1 mg/L.

The invention discloses a phycomycete crust cultivation method suitable for calcareous sand soil of a South China Sea coral island reef. According to the phycomycete crust cultivation method suitable for the calcareous sand soil of the South China Sea coral island reef, an in-situ phycomycete crust is directly propagated and domesticated, and the cultivated phycomycete crust is directly inoculated in the field, so that the separation and purification process is omitted, the culture speed is high, the material consumption is reduced, the field adaptive capacity of the artificially cultivated phycomycete crust is improved, and the phycomycete crust cultivation method has an important application value for ecological system restoration of the South China Sea coral island reef.

The invention discloses a preparation method of 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The method comprises the following steps: under the action of anhydrous p-methylbenzenesulfonic acid, carrying out condensation reaction on 3-benzyloxy-4-methoxyaniline and ethyl 3,3-diethoxypropionate to obtain ethyl 3-(3-benzyloxy-4-methoxyphenyl)imino propionate; and without the need for separation and purification, directly adding a high-boiling-point non-protonic solvent to perform cyclization reaction, thereby obtaining the 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The reaction formula is disclosed in the specification. The whole process is simple to operate, and saves the separation and purification link in the intermediate step. The preparation method is simple to operate, has the advantages of high safety, mild reaction conditions, high yield and low requirements for reactors, and can easily implement industrial production. The 3-benzyloxy-4-methoxyaniline can be obtained by carrying out oxygen atom alkylation and nitro reduction on the initial raw material 2-methoxy-5-nitrophenol; and the initial raw material 2-methoxy-5-nitrophenol is cheap and accessible.