Product
Patsnap Eureka
For R&D, Patsnap Eureka makes reading and utilizing patents & technical documents easy.
Patsnap Eureka AIR
Designed for self-driven R&D workflows. Generate viable solutions, solve complex R&D challenges, empower your innovation with AI.
Patsnap Eureka Materials
Designed for material experts only. Revolutionize your material R&D, from search, analyze, to developing new materials.
Feature
TechResearch
Generate reliable direction feasibility study reports for your R&D in just a few steps.
TechSeek
Discover and master advanced knowledge NOW. Basics, ideas, possibilities, all at once.
TechMind
As an expert in R&D Theories, TechMind can generates customized viable solutions instantly.
TechRisk
Analyze your overall solution with one click, know your potential R&D risks in advance.
TechMonitor
Get weekly tech updates, stay abreast of the latest tech innovations and key insights.
Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
42results about How to "Eliminate separation and purification" patented technology
Efficacy Topic
Property
Owner
Technical Advancement
Application Domain
Technology Topic
Technology Field Word
Patent Country/Region
Patent Type
Patent Status
Application Year
Inventor
Method for co-production of oligose and dietary fiber through wheat bran fermentation
InactiveCN102605022AEliminate separation and purificationEliminate bad effectsClimate change adaptationMicroorganism based processesPullulanAdditive ingredient
The invention relates to application of a microbial fermentation method in co-production of wheat bran oligose and dietary fiber. The invention aims to developed and utilize the wheat bran comprehensively; an efficient biological process route is adopted to deeply processing wheat bran, and the microbial fermentation method is used to prepare wheat bran dietary fiber and functional oligose simultaneously. The microbe used in the method refers to a single strain, pullularia pullulans or mixed strains of aureobasidium pulluans and agrocybe aegerita; in fermentation of wheat bran, substances in the wheat bran, such as starch and protein, can be taken as nutritional ingredients for the growth of microbes, when digesting the substances, the microbes can generate xylanase so as to hydrolyze wheat bran hemicellulose to generate oligose and prepare dietary fiber simultaneously. According to the method, the research and development idea of developing a single product is broken through, the rate of multipurpose utilization of the resource is high, the production costs is low, chemical substance residual does not exist, the environment is not polluted, a new processing technology model of 'ecological, low-carbon and efficient circulating' is formed, and the additional value of the wheat bran product is increased.
Owner:YANCHENG INST OF TECH
Preparation method of L-tyrosine or L-tyrosine derivative employing enzyme conversion
ActiveCN103343149AImprove conversion efficiencyEliminate separation and purificationMicroorganism based processesFermentationTyrosinePerylene derivatives
The invention belongs to the technical field of organisms, and particularly relates to a preparation method of L-tyrosine or L-tyrosine derivative (L-3-hydroxy tyrosine) employing enzyme conversion. The preparation method comprises the steps of: adopting feed liquid containing pyruvic acid as a substrate; adding bacterial cells with tyrosine phenol lyase activity, or crude enzyme, ammonia water, phenol or pyrocatechol; carrying out enzymatic reaction under the conditions that the temperature is 25-55 DEG C and the pH is 7-11; and separately preparing a converted product L-tyrosine or L-dioxyphenylalanine by using an isoelectric point crystallization method. By adopting the method, the L-tyrosine or L-dioxyphenylalanine with high additional value is synthetized by using cheap pyruvic acid liquid as the substrate by an enzymic method; the preparation method has the advantages of being wide in material source, high in enzymatic conversion efficiency, simple and convenient to operate, low in production cost and the like.
Owner:NANJING UNIV
Recombinant saccharomyces cerevisiae and application thereof to glutamine dipeptide synthesis
ActiveCN106754447AEliminate separation and purificationEfficient productionFungiMicroorganism based processesBiotechnologyDipeptide
The invention discloses a recombinant saccharomyces cerevisiae and application thereof to glutamine dipeptide synthesis. The recombinant saccharomyces cerevisiae contains an exogenous gene with the nucleotide sequence shown as SEQ ID NO.1. The invention further discloses a recombinant vector containing the gene, the recombinant saccharomyces cerevisiae and a method for glutamine dipeptide synthesis through biotransformation by using the recombinant saccharomyces cerevisiae. The condition that saccharomyces cells still have high catalytic activity after the multi-time circulation utilization is discovered; the obvious industrial advantages are realized. The method and the application provided by the invention have the advantages that the raw materials are cheap and can be easily obtained; the operation is simple and convenient and can be easily controlled; the synthesis path is green and efficient; the biosecurity is high; the reaction speed is high; the conversion rate is high, and the like; The foundation is laid for the industrial production of the glutamine dipeptide.
Owner:INNOBIO CORP LTD
Method for synthesizing 1-alkyl-2-alkoxyl-3-indole aldoxime derivant
The present invention relates to a method used for synthesizing derivatives of 1-alkyl-2-alkoxy-3-indole aldehyde oxime. Indole-one is used as basic material and treated through Vilsmeier-Hacck formylation reaction and alkylation reaction to prepare 1-alkyl-2-chlorine-3-indole aldehyde; under the conditions with potassium hydroxide and fatty alcohol and at the temperature of 50 to 80 DEG C, the reaction is monitored by a thin chromatogram TLC; after the reaction is completed, no treatment is required and hydroxylamine hydrochloride is directly added into the mixture for oximation reaction; the reaction temperature is maintained; the reaction lasts for 1 to 2 hours; the ratio of the 1-alkyl-2-chlorine-3-indole aldehyde, the hydroxylamine hydrochloride, the potassium hydroxide, the fatty alcohol and water is equal to 1mmol to 2mmol to 2mmol to from 5ml to 8 ml to 1ml; finally water is added for sedimentation, and the novel compounds of the category of the 1-alkyl-2-chlorine-3-indole aldehyde can be separated through filtration and chromatography. The method has the advantages of mild reaction conditions, process under atmospheric pressure, simple operation, less investment in the equipment, low production costs, less pollution and high yield.
Owner:BOHAI UNIV
Application of hybrid antibacterial peptide as the feed supplement
InactiveCN103621795AEliminate separation and purificationReduce manufacturing costAnimal feeding stuffAccessory food factorsBiotechnologyYeast
The invention belongs to the biotechnological field, and particularly relates to a technique for preparing a feed supplement through gene recombination of designed antibacterial peptide in yeast. The application of hybrid antibacterial peptide as the feed supplement is characterized by comprising the following steps: performing gene recombination of the hybrid antibacterial peptide onto a pRHZ-41L carrier, wherein the hybrid antibacterial peptide adopts a primary structure of GLPLLISWIKRKRQQ-AGP-GSKKPVPIIYCNRRTGKCQRM; transforming the recombinant carrier into S. pombe; cultivating on an MAA solid medium for 5 days; picking single colony from the solid medium to be inoculated onto a liquid EMM culture medium for cultivation for 3 days; cultivating engineering bacteria in an enlarged scope; filtering out the culture medium after large scale fermentation of the engineering bacteria, and adding into feed or drinking water after drying. According to the invention, the S.pombe can be directly used for expressing the antibacterial peptide, and then directly for preparing the feed supplement, so that the protein separation and purification process can be omitted, and accordingly, the production cost is reduced, the livestock resistibility is increased, and the use of antibiotics is reduced.
Owner:钱坤
Method and apparatus for producing propylene
ActiveCN101506126AHigh yieldEfficient productionMolecular sieve catalystHydrocarbons from unsaturated hydrocarbon additionBoiling pointAtmospheric pressure
A process for producing propylene, comprising the steps of: feeding at least one member selected from dimethyl ether and methanol into a reactor to cause the reaction in the presence of a catalyst; feeding a reaction product produced in the reactor into a separator to separate a low-boiling-point compound having a boiling point of -50 DEG C or lower under atmospheric pressure from the reaction product by the separator; and refluxing 70% or more of the entire amount of the low-boiling-point compound into the reactor.
Owner:JGC CORP
Method for production of o-xylene from coal based raw materials
ActiveCN107266276AReduce coking and carbon depositionIncrease contactHydrocarbon by isomerisationHydrocarbonsIsomerizationStrong acids
The invention relates to a method for production of o-xylene from coal based raw materials. The method adopts cheap coal based crude benzene and coal based crude methanol as the raw materials, employs a weak acid and medium strong acid based alkylation catalyst with large surface area and an anti-coking alkylation reaction medium, and carries out pickling, hydropretreating, alkylation reaction, rectification, isomerization reaction, and transalkylation reaction for high selectivity production of o-xylene; optionally, the method further comprises toluene disproportionation reaction. The alkylation reaction is carried out in a fixed bed, fluidized bed or moving bed reactor, the catalyst is a two-metal oxide modified flake MCM-56, nano acicular ZSM-5, flake MCM-49 or nano Beta molecular sieve, or a compound thereof; the isomerization, transalkylation and disproportionation reactions also use the novel special catalyst, and are all carried out in a fixed bed reactor. The method provided by the invention can effectively reduce the production cost of o-xylene, and completely realizes non-petroleum route production thereof.
Owner:TONGJI UNIV
Method for preparing feruloyl oligosaccharides through rice bran fermentation
InactiveCN106086113AEasy to purifyEliminate separation and purificationMicroorganism based processesFermentationMicroorganismHydrolysis
The invention discloses a method for preparing feruloyl oligosaccharides through rice bran fermentation. According to the method, a rice bran culture medium is prepared through preparation of a rice bran solution, and the feruloyl oligosaccharides are prepared. The feruloyl oligosaccharides are prepared with a fermentation method, the process of enzyme production by means of microorganisms and the enzymolysis process are integrated, the separation and purification procedure in the enzymic preparation production process is omitted, the cost is reduced, and the yield is increased. Besides, the problem about treatment of hydrolysis substances in the enzymolysis process is solved through utilization of starch, protein and other ingredients in the microorganism growth process, resources are reasonably utilized, and environment pollution is reduced. The method is simple and easy to implement, the yield of the prepared feruloyl oligosaccharides is high, and purification is easy.
Owner:JILIN ACAD OF AGRI SCI
Biosynthesis method of beta-alanine
InactiveCN108048500AOvercome transmembrane resistanceImprove stabilityMicroorganism based processesFermentationBiotechnologyReaction rate
The invention discloses a biosynthesis method of beta-alanine, which includes reaction of transforming and compounding beta-alanine by recombined brewing yeast full cell catalyzed L- asparaginic acid,wherein the recombined brewing yeast contains exogenous L- aspartic acid-alpha- decarboxylase encoding gene. The method and application have advantages of low-priced and easy-acquired raw materials,simple and easy-controlled operation, green and high-efficient synthetic route, good in biological safety, quick in reaction rate, high in converting rate, and others; the method and application alsolay a foundation of the industrialization of beta-alanine.
Owner:INNOBIO CORP LTD
Process for synthesizing propyl gallate in organic phase by microbiological method
InactiveCN1635127AEliminate separation and purificationImprove toleranceFermentationGallic acid esterTannase
The invention discloses a method for synthesizing gallic acid propyl ester in organic phase by microbe method. The method comprises the following steps: 1) collecting and filtering the mycelia cultured from aspergillus niger spores; 2) flushing with 0.85% (w / v) NaCl solution, balancing in 0.01~0.02mol / L pH 2.2~5.8 buffer solution and filtering to obtain the mycelia containing 60~80% (w / w) water; 2) in organic solvent benzene system, charging 0.06~0.1L normal propyl alcohol and 4~10mmol gallic acid into each liter organic solvent, then charging 20~50g said aspergillus niger mycelia into each liter organic solvent, implementing the biological catalytic reaction with the 150~220rpm stirring speed and under the temperature of 20~50íµ for 48~96 hours. The invention establishes the fermentation culture medium for the tannases of aspergillus niger, omits the separation and purification of the enzyme and lower the production cost by using the aspergillus niger as the biological catalyst instead of traditional free enzymes or fixed enzymes.
Owner:ZHEJIANG UNIV
Method for preparing functional polymer micro-porous membrane with reaction-solution phase inversion control method
InactiveCN105801859AHigh porosityHigh breaking strengthMembranesSemi-permeable membranesPolymer scienceSolvent
The invention belongs to the technical field of functional polymer membrane separation, and relates to a method for preparing a crown-ether graft polymer micro-porous membrane with a reaction-solution phase inversion control method. The method includes the steps that a chloromethyl-containing polymer such as polysulfone or polyether sulfone or polyether ether ketone is dissolved into a reaction solvent, an active-amido containing crown ether compound such as 4-aminobenzene-15-crown-5 is added, and a crown ether graft polymer is prepared through a nucleophilic substitution reaction between chloromethyl and amino; the grafting ratio of the reaction is controlled; in other words, when a reaction system is in certain viscosity, the reaction is terminated to prevent gelatinizing, the reaction system at the moment serves as a membrane casting solution, and the crown-ether graft polymer micro-porous membrane is prepared with the solution phase inversion method. As a cross bond exists in the polymer system, it can be achieved that the polymer micro-porous membrane which is high in porosity ratio and breaking strength is prepared under the low solid content of the polyether, and the separation step and the purification step of the grafted polymer are omitted; as a crown ether group exists, the polymer membrane has excellent lithium isotope separation performance.
Owner:TIANJIN POLYTECHNIC UNIV
Preparation method of 2-methylamino-5-t-butyl-1,3,4-thiadiazole
ActiveCN105524017AEliminate separation and purificationThe reaction conditions are not harshOrganic chemistryPivalic acidThiourea
The invention provides a preparation method of 2-methylamino-5-t-butyl-1,3,4-thiadiazole. Pivalic acid directly used as a raw material reacts with methylthiosemicarbazide with solid phosgene or a phosgene dimer or phosgene as an acylation reagent and a cyclization reagent to synthesize 2-methylamino-5-t-butyl-1,3,4-thiadiazole. The preparation method allows highly pure 2-methylamino-5-t-butyl-1,3,4-thiadiazol to be prepared, has the advantages of very high yield, safe operation, very low production cost, solving of the defects of existing production technologies, environmental protection and no pollution.
Owner:JIANGSU HANLIAN BIOTECH CO LTD
Preparation method of polyphosphoester
The invention relates to a preparation method of polyphosphoester. According to the method, phosphorus oxychloride, dialkyl phenol and hydroquinone are prepared into polyphosphoester through a one-step method, and finally the polyphosphoester is terminated by using phenol. The method includes the steps that the phosphorus oxychloride and the dialkyl phenol are used for generating monomer monophenyl ester, then polymerization is conducted through the hydroquinone to obtain a poly-phospholipid intermediate, and the intermediate is terminated by using phenol. The polymerization degree is 1-20. The method is carried out at normal pressure according to synthesis conditions, the process is simple, the safety coefficient is high, and the polyphosphoester is wide in application range, can serve asa solid flame retardant, has the advantages of being resistant to volatilization, migration and radiation, high in heat resistance, good in compatibility, low in toxicity and durable in flame retardant effect, can serve as a plasticizer for materials, and has the advantages of being high in toughness, small in brittleness and capable of improving the mechanical properties such as material notch impact strength.
Owner:HUAIHAI INST OF TECH
Method for degrading sulfonamide compound by using pycnoporus sanguineus
InactiveCN106277362AEliminate separation and purificationShorten fermentation timeWater contaminantsBiological water/sewage treatmentWastewaterNitrogen
The invention discloses a method for degrading a sulfonamide compound by using pycnoporus sanguineus. The method comprises the following steps: (1) culturing pycnoporus sanguineus of which the preservation serial number is CGMCC 5.815 so as to obtain a pycnoporus sanguineus first-grade seed; (2) centrifuging the pycnoporus sanguineus first-grade seed, abandoning the supernate, and resuspending and fermenting a bacterium body by using a fermentation culture medium; (3) mixing sulfonamide compound production discharge wastewater and fermentation broth, adding 2,2-coupled nitrogen-di(3-ethyl-benzothiazole-6-sulfonic acid) diammonium salt, and degrading. By adopting the method disclosed by the invention, not only are culture conditions for rapidly generating laccase by using the pycnoporus sanguineus in the absence of an inducer provided, but also a method for degrading the sulfonamide compound by using the whole bacterium body and an ectoenzyme environment in the fermentation broth is established, and a series of tedious steps such as separation and purification can be avoided. The fermentation time is short, and the degradation rate is high. The degradation process can be accurately repeated, and is very stable.
Owner:TIANJIN UNIV
Pestalotia funereal pathogenic bacteria molecule detection kit and use method thereof
InactiveCN102952883AEliminate separation and purificationShortened cultureMicrobiological testing/measurementMicrobiologyPathogenic bacteria
The present invention discloses a Pestalotia funereal pathogenic bacteria molecule detection kit and a use method thereof. The kit comprises the following components: 16 muL of ultra pure water d.d.H2O, 2 muL of an upstream primer F (5'-3') (GTCAACCAGCGGAGGGAT), 2 muL of a downstream primer R (5'-3') (CGCCGTTGTATTTCAGGAG), and 25 muL of Premix. With the present invention, rapid Pestalotia funereal detection can be achieved, sensitivity is high, the kit can be used in early plant disease detection, and strong technical supports are provided for development of targeted Pestalotia funereal prevention and control and Pestalotia funereal problem solution in time.
Owner:SICHUAN AGRI UNIV
Method using neutralizing wastewater in BHT (butylated hydroxytoluene) production to produce sodium p-toluenesulfonate
InactiveCN110294695AEliminate the separation and purification processSimple processOrganic chemistryOrganic compound preparationHydrogenSodium-p-toluenesulfinate
The invention belongs to the technical field of chemical engineering, and particularly relates to a method using neutralizing wastewater in BHT (butylated hydroxytoluene) production to produce sodiump-toluenesulfonate. The neutralizing wastewater comprises sodium p-toluenesulfonate and an alkaline neutralizing agent. The method comprises the following steps of step 1, adjusting the pH (potentialof hydrogen) value of the produced neutralizing wastewater in BHT production process to 6 to 7; step 2, discoloring the neutralizing wastewater with adjusted pH value by an adsorbent; step 3, filtering the discolored neutralizing wastewater, evaporating and concentrating, cooling, and crystallizing, so as to obtain a crude product of the sodium p-toluenesulfonate. The method has the advantages that the wastewater of the BHT technology can be eliminated, the difficult problem of environment protection is solved, the wastewater can be recycled as resource, the production cost of the sodium p-toluenesulfonate is reduced, and the economic benefit is increased.
Owner:江苏迈达新材料股份有限公司
3,5,6-trichloropyridin-2-ol sodium synthesis method
InactiveCN104163789AReduce generationIncrease contentOrganic chemistryWater dischargeSynthesis methods
The invention discloses a novel method for fractional step method-based preparation of 3,5,6-trichloropyridin-2-ol sodium from trichloro-acetic chloride and acrylonitrile as main raw materials. Trichloro-acetic chloride and acrylonitrile undergo a series of reactions under the action of a solvent and a catalyst to produce 3,5,6-trichloropyridin-2-ol sodium, and tetrachloropyridine as a side product does not need separation and purification and can be directly treated and transformed into 3,5,6-trichloropyridin-2-ol sodium as a target product by an alkali liquid so that a yield is greatly improved. The 3,5,6-trichloropyridin-2-ol sodium synthesis method is simple, has a less waste water discharge capacity, realizes high-efficiency 3,5,6-trichloropyridin-2-ol sodium synthesis by simple and easy processes, produces the high-purity high-yield product and is suitable for large-scale industrial production.
Owner:ANHUI COSTAR BIOCHEM CO LTD
Method for rapidly determining content of phenol in wastewater through purge and trap-gas chromatography-mass spectrometry
PendingCN114216973APrevent purityAvoid askingComponent separationO-Phosphoric AcidIndustrial waste water
The invention relates to a method for rapidly determining the content of phenol in wastewater by purge and trap-gas chromatography-mass spectrometry, which comprises the following steps: 1) collecting a wastewater sample, adding phosphoric acid, and adjusting the pH value of the wastewater sample to weak acidity; (2) purging phenol in the wastewater sample by using a purging and trapping sample injector, trapping the phenol by using a trapping trap, and then analyzing the phenol to enter a gas chromatograph-mass spectrometer; and (3) carrying out qualitative and quantitative analysis on the phenol trapped by the trapping trap by using a gas chromatograph-mass spectrometer. Compared with the prior art, the method for measuring the phenol content in the industrial wastewater is simple, rapid, efficient and accurate, the wastewater with complex components and high organic matter concentration can be directly purged, the pretreatment processes such as separation and purification are omitted, an organic solvent is not needed for extraction, the detection cost is reduced, and the method is suitable for large-scale popularization and application. The time for detecting a group of water samples is shortened from two hours to about 30 minutes, and the detection limit is 0.01-1 mg / L.
Owner:SHANGHAI INST OF TECH +1
Phycomycete crust cultivation method suitable for calcareous sand soil of South China Sea coral island reef
ActiveCN113287382AGood adaptabilityImprove resilienceFungiSoil-working methodsEdaphicCoral Sea Islands
The invention discloses a phycomycete crust cultivation method suitable for calcareous sand soil of a South China Sea coral island reef. According to the phycomycete crust cultivation method suitable for the calcareous sand soil of the South China Sea coral island reef, an in-situ phycomycete crust is directly propagated and domesticated, and the cultivated phycomycete crust is directly inoculated in the field, so that the separation and purification process is omitted, the culture speed is high, the material consumption is reduced, the field adaptive capacity of the artificially cultivated phycomycete crust is improved, and the phycomycete crust cultivation method has an important application value for ecological system restoration of the South China Sea coral island reef.
Owner:SOUTH CHINA SEA INST OF OCEANOLOGY - CHINESE ACAD OF SCI
Preparation technology of chlorantraniliprole impurity
ActiveCN108033944AEliminate separation and purificationReduce dosageOrganic chemistryOrganic synthesisBromine
The invention discloses a preparation technology of chlorantraniliprole impurity, and belongs to the technical field of organic synthesis. The technical problem to be solved by the invention is to provide a high-efficiency and low-cost technology for preparing a series of chlorantraniliprole impurity. The technology comprises the following steps: firstly using M1 as a raw material to prepare a compound M2, then carrying out oxidation and bromination with a one-pot method to prepare and obtain S1, then carrying out hydrolysis on S1 to prepare and obtain S2, and carrying out amidation on S2 to prepare S3. According to the method, separation and purification of an intermediate M2 are eliminated, the using amounts of a brominating agent and a solvent are reduced, the technological steps are shortened, the production cost is reduced, and dangerous chemical reagents such as bromine and hydrogen peroxide do not need to be used; according to the method, a series of chlorantraniliprole impuritycan be prepared, and effective guarantee is provided for production quality control for chlorantraniliprole.
Owner:LIER CHEM CO LTD +1
Method for biologically removing tetracycline antibiotics
ActiveCN110904002AImprove bioremoval efficiencyPromote degradationBacteriaWater contaminantsBiotechnologyBacillus amyloliquefaciens
The invention discloses a method for biologically removing tetracycline antibiotics. The method comprises the following steps: (1) seed culture: culturing secondary seeds of bacillus clausii and bacillus amyloliquefaciens; and (2) removal: mixing a water body containing tetracycline antibiotics with a fermentation medium to prepare a degradation solution, inoculating bacillus clausii secondary seeds and HM-618 secondary seeds into the degradation solution, and fermenting. A co-culture system of bacillus clausii and bacillus amyloliquefaciens is established and added into a water body containing tetracycline antibiotics, so that the bacillus amyloliquefaciens produces surface active substances in situ to promote biological removal of the tetracycline antibiotics, and a series of tedious steps such as separation and purification of a surfactant are omitted; according to the method, the biological removal efficiency of the tetracycline antibiotics is improved, and the biotoxicity of tetracycline antibiotic conversion products is remarkably reduced.
Owner:TIANJIN UNIV
Preparation method of L-tyrosine or L-tyrosine derivative employing enzyme conversion
ActiveCN103343149BImprove conversion efficiencyEliminate separation and purificationMicroorganism based processesFermentationSal ammoniacAdditional values
The invention belongs to the technical field of organisms, and particularly relates to a preparation method of L-tyrosine or L-tyrosine derivative (L-3-hydroxy tyrosine) employing enzyme conversion. The preparation method comprises the steps of: adopting feed liquid containing pyruvic acid as a substrate; adding bacterial cells with tyrosine phenol lyase activity, or crude enzyme, ammonia water, phenol or pyrocatechol; carrying out enzymatic reaction under the conditions that the temperature is 25-55 DEG C and the pH is 7-11; and separately preparing a converted product L-tyrosine or L-dioxyphenylalanine by using an isoelectric point crystallization method. By adopting the method, the L-tyrosine or L-dioxyphenylalanine with high additional value is synthetized by using cheap pyruvic acid liquid as the substrate by an enzymic method; the preparation method has the advantages of being wide in material source, high in enzymatic conversion efficiency, simple and convenient to operate, low in production cost and the like.
Owner:NANJING UNIV
A kind of ionic liquid electrolyte for ultra-high stability aluminum electrolytic capacitor and preparation method thereof
ActiveCN111681877BImprove conductivityImprove performanceLiquid electrolytic capacitorsElectrolytic agentGlycol synthesis
Owner:SHANGHAI JIAOTONG UNIV +1
Process for synthesizing propyl gallate in organic phase by microbiological method
InactiveCN1277929CEliminate separation and purificationImprove toleranceMicroorganism based processesFermentationGallic acid esterTannase
The invention discloses a method for synthesizing gallic acid propyl ester in organic phase by microbe method. The method comprises the following steps: 1) collecting and filtering the mycelia cultured from aspergillus niger spores; 2) flushing with 0.85% (w / v) NaCl solution, balancing in 0.01-0.02mol / L pH 2.2-5.8 buffer solution and filtering to obtain the mycelia containing 60-80% (w / w) water; 2) in organic solvent benzene system, charging 0.06-0.1L normal propyl alcohol and 4-10mmol gallic acid into each liter organic solvent, then charging 20-50g said aspergillus niger mycelia into each liter organic solvent, implementing the biological catalytic reaction with the 150-220rpm stirring speed and under the temperature of 20-50 DEG C for 48-96 hours. The invention establishes the fermentation culture medium for the tannases of aspergillus niger, omits the separation and purification of the enzyme and lower the production cost by using the aspergillus niger as the biological catalyst instead of traditional free enzymes or fixed enzymes.
Owner:ZHEJIANG UNIV
A method for the biological removal of tetracycline antibiotics
ActiveCN110904002BImprove bioremoval efficiencyPromote degradationBacteriaWater contaminantsBiotechnologyBacillus amyloliquefaciens
The invention discloses a method for biologically removing tetracycline antibiotics, comprising the following steps: (1) seed cultivation: culturing secondary seeds of Bacillus clausii and Bacillus amyloliquefaciens; (2) removing: removing tetracycline antibiotics The degraded water is mixed with the fermentation medium to form a degradation solution, and the secondary seeds of Bacillus clausii and the secondary seeds of HM-618 are inserted into the degradation solution for fermentation. The invention establishes a co-cultivation system of Bacillus clausii and Bacillus amyloliquefaciens, and adds them to the water body containing tetracycline antibiotics, so that Bacillus amyloliquefaciens in situ produces surface active substances, promotes the biological removal of tetracycline antibiotics, saves money A series of tedious steps such as separation and purification of surfactants are eliminated; the invention not only improves the biological removal efficiency of tetracycline antibiotics, but also significantly reduces the biological toxicity of tetracycline antibiotics transformation products.
Owner:TIANJIN UNIV
Preparation method of 7-benzyloxy-6-methoxy-4-hydroxyquinoline
InactiveCN106946774ASimple and efficient operationEliminate the separation and purification processOrganic chemistrySolventChemistry
The invention discloses a preparation method of 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The method comprises the following steps: under the action of anhydrous p-methylbenzenesulfonic acid, carrying out condensation reaction on 3-benzyloxy-4-methoxyaniline and ethyl 3,3-diethoxypropionate to obtain ethyl 3-(3-benzyloxy-4-methoxyphenyl)imino propionate; and without the need for separation and purification, directly adding a high-boiling-point non-protonic solvent to perform cyclization reaction, thereby obtaining the 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The reaction formula is disclosed in the specification. The whole process is simple to operate, and saves the separation and purification link in the intermediate step. The preparation method is simple to operate, has the advantages of high safety, mild reaction conditions, high yield and low requirements for reactors, and can easily implement industrial production. The 3-benzyloxy-4-methoxyaniline can be obtained by carrying out oxygen atom alkylation and nitro reduction on the initial raw material 2-methoxy-5-nitrophenol; and the initial raw material 2-methoxy-5-nitrophenol is cheap and accessible.
Owner:JIAXING UNIV
Method for synthesizing 1-alkyl-2-alkoxyl-3-indole aldoxime derivant
InactiveCN101270071BLow temperature requirementLess investmentOrganic chemistryFiltrationFormylation reaction
Owner:BOHAI UNIV
Recombinant Saccharomyces cerevisiae and its application in synthesizing dipeptide
ActiveCN106754447BEliminate separation and purificationEfficient productionFungiMicroorganism based processesDipeptideNucleotide
The invention discloses a recombinant saccharomyces cerevisiae and application thereof to glutamine dipeptide synthesis. The recombinant saccharomyces cerevisiae contains an exogenous gene with the nucleotide sequence shown as SEQ ID NO.1. The invention further discloses a recombinant vector containing the gene, the recombinant saccharomyces cerevisiae and a method for glutamine dipeptide synthesis through biotransformation by using the recombinant saccharomyces cerevisiae. The condition that saccharomyces cells still have high catalytic activity after the multi-time circulation utilization is discovered; the obvious industrial advantages are realized. The method and the application provided by the invention have the advantages that the raw materials are cheap and can be easily obtained; the operation is simple and convenient and can be easily controlled; the synthesis path is green and efficient; the biosecurity is high; the reaction speed is high; the conversion rate is high, and the like; The foundation is laid for the industrial production of the glutamine dipeptide.
Owner:INNOBIO CORP LTD
Method for preparing Salen Ni
ActiveCN102304062BEliminate separation and purificationReduce typesImino compound preparationSalicylaldehydeHexamethylenediamine
The invention discloses a method for preparing salen Ni. The method comprises the following steps of: reacting cyclohexane diamine and salicylide or a salicylide derivative in an organic solvent to generate a Schiff alkali ligand; reacting by adding a nickel acetate aqueous solution; carrying out coordination on Ni2+ and Schiff alkali; taking organic phase of the obtained final reaction liquid; obtaining a salen Ni crude product by removing the solvent; and re-crystallizing the crude product to obtain the salen Ni. According to the method disclosed by the invention, the proper solvent and reaction condition can be selected; process parameters are optimized; post-processing equipment is greatly simplified; the cost is reduced; the generated by-products are reduced; the product purity is increased; compared with the prior art, the process route is simplified; the three wastes (waste gas, waste water and industrial residue) can be reduced; and the method is more advantageous for industrial implementation.
Owner:CHEM TECH ACAD OF SHANDONG PROVINCE +1
The preparation method of 7-benzyloxy-6-methoxy-4-hydroxyquinoline
InactiveCN106946774BSimple and fast operationEliminate separation and purificationOrganic chemistrySolventNitro reduction
The invention discloses a preparation method of 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The method comprises the following steps: under the action of anhydrous p-methylbenzenesulfonic acid, carrying out condensation reaction on 3-benzyloxy-4-methoxyaniline and ethyl 3,3-diethoxypropionate to obtain ethyl 3-(3-benzyloxy-4-methoxyphenyl)imino propionate; and without the need for separation and purification, directly adding a high-boiling-point non-protonic solvent to perform cyclization reaction, thereby obtaining the 7-benzyloxy-6-methoxy-4-hydroxyquinoline. The reaction formula is disclosed in the specification. The whole process is simple to operate, and saves the separation and purification link in the intermediate step. The preparation method is simple to operate, has the advantages of high safety, mild reaction conditions, high yield and low requirements for reactors, and can easily implement industrial production. The 3-benzyloxy-4-methoxyaniline can be obtained by carrying out oxygen atom alkylation and nitro reduction on the initial raw material 2-methoxy-5-nitrophenol; and the initial raw material 2-methoxy-5-nitrophenol is cheap and accessible.
Owner:JIAXING UNIV
Who we serve
- R&D Engineer
- R&D Manager
- IP Professional
Why Patsnap Eureka
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com