Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of method and application of improving microbial organic selenium synthesis ability based on sulfur-containing protein overexpression

A microorganism and organic selenium technology, applied in the field of organic selenium production and selenium enrichment, can solve the problems of exceeding the consumption capacity of the general population, harsh nutritional conditions of brewer's yeast, and high price of selenium-enriched yeast products, achieving obvious transformation effect of organic selenium and improving biological The effect of material yield, high-efficiency selenium enrichment and safety

Active Publication Date: 2021-07-13
XI AN JIAOTONG UNIV
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] At present, the main method to improve the selenium-enrichment ability of microorganisms is to obtain starting strains with higher selenium tolerance through artificial screening, and to increase the inorganic selenium content in the medium during the fermentation process so that microorganisms can enrich more selenoproteins to improve microbial growth. The organic selenium content in the body, but so far only found that brewer's yeast has a high ability to tolerate selenium, which may be related to its original high protein content
However, the nutritional conditions of brewer's yeast are harsh, and the yield when used in the production of selenium-enriched yeast is low, resulting in high production costs. The price of selenium-enriched yeast products is very high, exceeding the consumption capacity of ordinary people

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of method and application of improving microbial organic selenium synthesis ability based on sulfur-containing protein overexpression
  • A kind of method and application of improving microbial organic selenium synthesis ability based on sulfur-containing protein overexpression
  • A kind of method and application of improving microbial organic selenium synthesis ability based on sulfur-containing protein overexpression

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0041] Example 1 Construction of artificially designed AC sulfur-containing protein recombinant yeast and determination of selenium-enriching ability

[0042] 1. Design of artificial sulfur-containing protein AC and its gene sequence

[0043] 1) Artificially design an alanine-cysteine ​​polymer as a sulfur-containing protein, with a total of 40 amino acids (AC40 for short), and its amino acid sequence is (AC)20. Among them, A represents alanine, C represents cysteine, and there are 20 sulfur-containing amino acids, accounting for 50%.

[0044] The total length of the AC gene sequence plus the start and stop codons is 126bp, and the sequence is as follows:

[0045] ATG (GCCTGC) 20 TGA (shown in SEQ.ID.NO.1).

[0046] 2) According to the yeast codon preference, optimize the codon sequence of AC40, determine its gene sequence, and add enzyme cutting sites upstream and downstream as follows:

[0047]

[0048] 2. Construction of recombinant expression vector

[0049] The ge...

Embodiment 2

[0064] Example 2 Construction of artificially designed MC sulfur-containing protein recombinant yeast and determination of selenium-enriching ability

[0065] 1. Design of artificial sulfur-containing protein MC and its gene sequence

[0066] 1) Artificially design a sulfur-containing protein composed of methionine and cysteine, with a total of 74 amino acids (referred to as MC74), which contains several gaps of glycine to meet the requirements of the protein structure, and the sequence is GG(MMMMMMGGCCGG)6. Among them, G represents glycine, M represents methionine, C represents cysteine, and the number of sulfur-containing amino acids is 48, accounting for about 65%. The total length of the MC gene sequence plus the start and stop codons is 228bp, and the sequence is as follows:

[0067] ATGGGTGGT (ATGATGATGATGATGATGGGTGGTTGTTGTGGTGGT) 6 T GA (as shown in SEQ.ID.NO.2).

[0068] 2) According to the yeast codon preference, optimize the codon sequence of MC74, determine its g...

Embodiment 3

[0085] Example 3 Construction of natural MT sulfur-containing protein recombinant bacteria and determination of selenium-enriching ability

[0086] 1. Natural rabbit metallothionein MT and its gene sequence

[0087] The most representative of natural sulfur-containing proteins is metallothionein MT, which is a metal-binding protein naturally formed in the process of biological evolution, and contains more sulfur-containing amino acids—cysteine. Studies have shown that the MT sequence is highly conserved, and the content of cysteine ​​is about 1 / 3 of the total amino acids. In this embodiment, the rabbit source MT protein is selected from the NCBI protein sequence database as a representative of natural sulfur-containing protein, and its amino acid sequence is:

[0088] MDPNCSCPTGGSCSCAGSCTCKACRCPSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCCA.

[0089] A total of 61 amino acids (MT61), of which C represents cysteine, a total of 20, sulfur-containing amino acids accounted for 32.8%. Addin...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a method for improving the synthesis ability of microorganism organic selenium based on the overexpression of sulfur-containing protein, which belongs to the technical field of organic selenium biosynthesis. cultivated in the environment. In the overexpression of exogenous sulfur-containing proteins, the sulfur in sulfur-containing amino acids (cysteine ​​and methionine) will be replaced by selenium to synthesize selenosulfur amino acids, and then selenoproteins will be synthesized to achieve efficient organic selenium synthesis by microorganisms. Based on the substitution and competition relationship between selenium and sulfur, this technology proposes a plan to use sulfur-containing proteins to synthesize organic selenium, construct foreign proteins containing sulfur through biotechnology, and form selenoproteins in transfected microorganisms, that is, organic selenium . Not only is it highly efficient and rich in selenium, but its safety is guaranteed.

Description

technical field [0001] The invention belongs to the technical field of selenium enrichment, in particular to the technical field of organic selenium production, and relates to a method and application for improving microbial organic selenium synthesis ability / effect based on the overexpression of sulfur-containing proteins. Background technique [0002] Selenium is an indispensable nutrient element for the human body. In the human body, selenium can resist viruses, delay aging, regulate the human immune system, and also have various functions such as improving vision, improving memory, preventing rheumatic bone pain, breathing, and gastrointestinal diseases. Selenium deficiency can lead to cancer, diabetes, cardiovascular disease, and immune system disease. [0003] Compared with other essential trace elements for the human body, the distribution of selenium in the earth's crust is extremely uneven around the world, and high-selenium soils are often located in relatively sma...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N1/19C12N1/21C12N15/81C12N15/70C07K14/00A23L33/135A23L33/16A23K10/18A23K20/20C12R1/84C12R1/19
CPCA23V2002/00A23K10/18A23K20/30A23L33/135A23L33/16C07K14/00C12N15/70C12N15/815A23V2200/30A23V2250/1626
Inventor 杨水云赵浩淼廖丹李少峰徐文赵良瑞温玉荣高恩方庆梅
Owner XI AN JIAOTONG UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com