Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

25 results about "NERVOUS DISORDERS" patented technology

Parkinson’s disease is a nervous system disorder whose main symptoms include tremors, rigidity of the trunk and extremities, slow movement and balance disorders. This nervous system disorder arises from a loss of brain cells that produce dopamine.

Neurological disease diagnosis system based on space-time attention and dynamic domain self-adaption

The invention discloses a neural disease diagnosis system based on space-time attention and dynamic field self-adaption. The method belongs to the technical field of cross-modal medical data adaptive analysis. The technical problem that a brand new system capable of simultaneously fusing multi-modal information and modeling multi-scale spatial-temporal features and having dynamic field adaptive ability is urgently needed to improve the accuracy and generalization ability of intelligent diagnosis of multi-site nerve diseases is solved. The system comprises a data preprocessing module for extracting a standardized time sequence of a brain region from fMRI time sequence data; the two-channel feature coding network module obtains global features through an attention mechanism; according to the feature fusion and classification module, a main task classifier executes a main task and predicts whether a to-be-tested person suffers from nerve diseases or not, and a domain task classifier executes a domain task and predicts a site to which the to-be-tested person belongs; and the dynamic balance training module adjusts the dynamic balance of the main task and the domain task through a dynamic balance control strategy.
Owner:CHANGCHUN UNIV

Postoperative rehabilitation intervention system for patients with neurological diseases based on evidence-based medicine

The present application relates to the technical field of postoperative rehabilitation, in particular to a postoperative rehabilitation intervention system for patients with neurological diseases based on evidence-based medical evidence. The steps implemented by the system include: obtaining characteristic data of a patient with a neurological disease to be analyzed and reference patients, a rehabilitation scheme of the reference patients and a postoperative Barthel index, calculating a reference factor of the reference patients corresponding to each rehabilitation scheme under each preoperative state; obtaining a comprehensive Barthel index of each rehabilitation scheme under each preoperative state by using the reference factor and the postoperative Barthel index, determining a correction factor under each preoperative state according to the comprehensive Barthel index, and correcting the comprehensive Barthel index to obtain a target Barthel index; determining a reference rehabilitation scheme by combining the similarity of the characteristic data of the patient with a neurological disease to be analyzed and different reference patients and the target Barthel index. The present application can improve the postoperative rehabilitation intervention effect for patients with neurological diseases.
Owner:SHAANXI PROVINCIAL HOSPITAL OF CHINESE MEDICINE

Polymorphs of N-Desmethyl Ruboxistaurin and Salts Thereof

Novel compositions of N-desmethyl ruboxistaurin L-lactate salt and L-lactate salt polymorphs. The use of compositions of N-desmethyl ruboxistaurin L-lactate salt and polymorphs to modulate GSK-3 signaling is disclosed, as is the use of compositions of N-desmethyl ruboxistaurin L-lactate salt and polymorphs to inhibit protein kinase C. Methods are also disclosed of using compositions of N-desmethyl ruboxistaurin L-lactate salt and polymorphs in the treatment of subjects having a neurological disease and / or psychiatric disorder, including Alzheimer's disease, bipolar disorder, depression, schizophrenia, Parkinson's disease, or neuroinflammation, as well as methods of using compositions of N-desmethyl ruboxistaurin L-lactate salt and polymorphs in treating conditions associated with diabetes mellitus or its complications, or ischemia, inflammation, pulmonary hypertension, congestive heart failure, cardiovascular disease, dermatological disease, or cancer. In addition, compositions of N-desmethyl ruboxistaurin L-lactate salt and polymorphs administered in combination with lithium or other treatments for bipolar disorder are also disclosed.
Owner:4M THERAPEUTICS INC

Brain venation plexus vesicle segmentation method

The invention discloses a brain venation plexus vesicle segmentation method, and the method comprises the steps: firstly reinforcing the signal contrast of the whole venation plexus through a high-resolution T1 enhanced image, and then achieving the stable segmentation of vesicles through employing the two steps: the whole segmentation of the venation plexus and the segmentation of the vesicles. In the vesicle segmentation process, as the vesicles are filled with cerebrospinal fluid, the difference between a venation plexus entity (high signal) and the cerebrospinal fluid (low signal) in a T1 enhanced image is utilized, a vesicle segmentation reference threshold value is set, and vesicle voxel separation is realized through low-pass filtering. According to the method, the vesicle structure of the cerebral venation plexus can be segmented, the volume of the vesicle structure can be calculated, and the volume of the vesicle of the cerebral venation plexus can be used as an image marker for auxiliary diagnosis of nerve diseases such as Alzheimer's disease.
Owner:SECOND AFFILIATED HOSPITAL ZHEJIANG UNIV COLLEGE OF MEDICINE

Combinations Comprising Psychedelics for the Treatment of Schizophrenia and Other Neuropsychiatric and Neurologic Disorders

This invention provides in some aspects, combinations, compositions and kits comprising a psychedelic drug and an NMD A receptor agonist and applications and uses of same for treating, reducing the incidence of, reducing the severity of or improving a pathology of a subject with a neurologic disease or disorder, a neurocognitive disease or disorder, or a motor disease or disorder, or for enhancing neuroplasticity in a subject with a neurologic disease or disorder, a neurocognitive disease or disorder, or a motor disease or disorder making use of the combinations, compositions and kits of this invention.
Owner:HADASIT MEDICAL RESEARCH SERVICES & DEVELOPMENT LTD +1

Steroid compound, and use thereof and preparation method therefor

The present invention relates to a steroid compound, a use thereof and a preparation method therefor. It is expected that such compound can effectively treat mental and neurological diseases, and has good active efficacy, pharmacokinetic (PK) performance, oral bioavailability, stability, safety, clearance rate, and / or metabolic performance and the like.
Owner:CHENGDU KANGHONG PHARMACEUTICAL GROUP CO LTD

Compositions and methods for reducing reactive microglia using 15-PGDH inhibitors

Provided herein are methods for reducing reactive microglia in a subject. Further provided herein are methods for treating a neurological disease, disorder, or condition in a subject. In some cases, the methods involve administering a 15-hydroxyprostaglandin dehydrogenase (15-PGDH) inhibitor to the subject. In some cases, the 15-PGDH inhibitor can penetrate the blood-brain barrier.
Owner:EPIRIUM BIO INC

Electroencephalogram signal controlled transcranial magnetic stimulation system and method

The invention relates to the technical field of transcranial magnetic stimulation, in particular to a transcranial magnetic stimulation system and method controlled by electroencephalogram signals. The system comprises an electroencephalogram acquisition module, a self-adaptive signal processing module, a dynamic stimulation control module, a reconfigurable transcranial magnetic stimulation module and a closed-loop feedback regulation module. The method comprises the following steps: collecting and preprocessing electroencephalogram signals of a subject; extracting multi-dimensional electroencephalogram features by combining wavelet packet decomposition and Hilbert-Huang transform through denoising of an improved U-Net model fused with physiological priori; dynamically optimizing stimulation parameters based on a particle swarm optimization algorithm; magnetic field focusing is realized by using a flexible coil array, and synchronous stimulation pulses are output by combining a phase locking mechanism; closed-loop feedback adjustment ensures that the stimulation effect reaches the standard. The problems that a traditional system is low in electroencephalogram analysis precision, poor in parameter adaptability, insufficient in focusing and low in synchronization precision are solved, the nerve regulation and control effect is improved, the damage risk of a non-target brain region is reduced, and the method is suitable for personalized treatment of nerve diseases such as depression and dyskinesia after cerebral apoplexy.
Owner:FOURTH MILITARY MEDICAL UNIVERSITY

Use of fisetin in the prevention / treatment of kif1a-related neurological diseases

The present application relates to the technical field of biological medicine, and particularly relates to the use of fisetin in preventing / treating KIF1A related neurological diseases. The inventor of the present application first discovers and confirms that treating Caenorhabditis elegans with R11Q mutation with plant flavonol fisetin can improve the movement of the animals. The discovery of the present application makes it possible to rescue R11Q deficiency at the biochemical and animal levels, and provides a new clue for the treatment of KIF1A related neurological diseases.
Owner:TSINGHUA UNIVERSITY

Systems and methods for monitoring and managing neurological diseases and conditions

PendingUS20260120838A1Drug and medicationsMedical equipmentDiseaseTreatment duration
Systems and methods for monitoring and managing neurological diseases and conditions are disclosed herein. In some embodiments, a method for monitoring a patient having a neurological disease or condition includes receiving, from one or more patient monitoring devices, first patient data for a baseline time period. The method can include determining, based on the first patient data, first seizure data and first side effect data during the baseline time period. The method can further include receiving, from the one or more patient monitoring devices, second patient data for a treatment time period, and determining, based on the second patient data, second seizure data and second side effect data during the treatment time period. The method can also include generating a personalized dose-response profile for the patient based on the first and second seizure data and the first and second side effect data.
Owner:EYSZ INC

Deep brain stimulation device, and control method thereof

According to a deep brain stimulation device and a control method thereof according to one embodiment of the present invention, two electrodes are inserted into a deep brain nucleus and supplied with high-frequency current in order to treat brain and neural diseases such as Parkinson's disease, tremor, myodystonia, Alzheimer's dementia, epilepsy, obsessive compulsive disorder, depression, pain, drug addiction, and post-traumatic syndrome, wherein the two electrodes are not supplied with current at the same time, thus making it possible to extend the life of a battery while achieving treatment effects that are the same as or superior to the prior art.
Owner:SEOUL NATIONAL UNIVERSITY R&DB FOUNDATION +1

Immunogenic scaffolds and use of same in antigenic peptide display

PCT designated stageWO2026009228A1Nervous disorderVirus peptidesDiseaseImmunogenicity
The present invention provides a recombinant protein including: (i) the amino acid sequence QLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILA (SEQ ID NO: 6) or an analog thereof having at least 90% identity thereto; (ii) a first peptide of interest: (iii) the amino acid sequence HTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLE (SEQ ID NO: 7) or an analog thereof having at least 90% identity thereto; and (iv) a second peptide of interest. Further provided is a method for treating a subject afflicted with a neurological disease or condition associated therewith by administration of the recombinant protein.
Owner:BG NEGEV TECHNOLOGIES & APPLICATIONS LTD

Systems and methods for eyelid localization

Systems and methods for localizing an upper eyelid in an image of a subject are provided. An image of an eye of the subject is obtained in electronic format. The image is inputted into a trained neural network comprising at least 10,000 parameters, thereby obtaining a set of coordinates for an upper eyelid in the image. This obtaining and inputting can be repeated over the course of a non-zero duration thereby obtaining a corresponding set of coordinates for the upper eyelid in each image in a plurality of images. Each corresponding set of coordinates for the upper eyelid from each image in the plurality of images can be used to determine whether the subject is afflicted with a neurological condition.
Owner:BLINKTBI INC

5-methoxy-n,n-dimethyltryptamine analogs, their synthesis, and methods for treatment of neurological, psychiatric, and substance use disorders

Disclosed are compounds having the structure:whereinZ1 is NR4, O, or S;Z2 is CR7 or N;n is 1 to 5;R1 is —H, halogen, —O-alkyl, or together with R2 forms —O—CH2—O—;R2 is —H, —OH, —O-alkyl, —O-alkyl-aryl, —S-alkyl, —S-alkyl-aryl, or together with R1 or R3 forms —O—CH2—O—;R3 is —H, —O-alkyl or together with R2 forms —O—CH2—O—;R4 is H or alkyl;R5 and R6 are each independently H, alkyl, alkenyl, alkynyl or NR5R6 together form a substituted or unsubstituted heterocycle, wherein the heterocycle may be monocyclic or bicyclic,R7 is H or alkyl;wherein R1 is F, when R2 is —O-(n-propyl) or when at least one of R5 or R6 is H, andwherein the compound is other than a compound whereZ1 is NR4 and R1, R2, R3, and R8 are H;n is 2, R1 is halogen, R2 is —OCH3, R3 is —H, R4 is —H, and R5 and R6 are both methyl;n is 2, R1 is —F, R2 is —OCH3, R3 is —H, R4 is —H, and NR5R6 together are —N-pyrrolidine;n is 2, R1 and R2 together forms —O—CH2—O—, R3 is —H, R4 is —H, and R5 and R6 are both methyl; andn is 2, R1 and R2 together forms —O—CH2—O—, R3 is —H,R4 is —H; and R5 and R6 are both isopropyl,or a pharmaceutically acceptable salt thereof.Also disclosed are processes for synthesizing the compounds, and methods for activating or selectively activating the 5HT1A receptor, or of simultaneously activating the 5HT1A and 5HT2A receptors, and of treating a subject afflicted with a neurological disease, psychiatric disorder, or substance use disorder, using the compounds.
Owner:MT SINAI SCHOOL OF MEDICINE +1

Methods and compositions for transgene delivery and / or reconstituting microglia

PendingUS20260130943A1Nervous disorderHydrolasesCX3CR1Disease
The present disclosure features CX3CR1 haploinsufficient HSPC and methods of using such cells for the treatment of a metabolic or neurological disorder. The disclosed methods include methods for making and modifying CX3CR1 haploinsufficient HSPC. Other disclosed methods include methods of treating a subject having or suspected of having a metabolic or neurological disease comprising administering to the subject a composition comprising CX3CR1 haploinsufficient HSPC.
Owner:CHILDRENS MEDICAL CENT CORP +1

Formulations of ion channel modulators and methods for preparing and using ion channel modulators.

PendingJP2026086664AOrganic active ingredientsPowder deliveryCortical spreading depressionNervous system
We provide formulations of ion channel modulators. [Solution] The present invention partially relates to compositions or dosage forms comprising condensed heteroaryl compounds useful for preventing and / or treating diseases or conditions associated with abnormal function of voltage-gated sodium ion channels, such as abnormal delayed / persistent sodium currents. Methods for treating diseases or conditions associated with abnormal function of sodium ion channels, including neurological disorders (e.g., Dravet syndrome, epilepsy), pain, neuromuscular disorders, trigeminal-autonomic headache (TAC), migraines, cranial nerve disorders or polycranial nerve disorders, and cortical spreading depression (CSD), are also provided herein. In another aspect, the present invention provides methods for producing ion channel modulators.
Owner:PRAXIS PRECISION MEDICINES INC

Neck near-infrared light stimulation and head magnetic stimulation wearable cognitive function improvement system

The invention discloses a neck near-infrared light stimulation and head magnetic stimulation wearable cognitive function improvement system, and belongs to the technical field of nerve regulation and control. The system comprises a high-intensity narrow-pulse near-infrared light stimulation module for the neck and the lower jaw, a low-intensity composite rhythm magnetic stimulation module for the forehead lobe and the temporal lobe, a portable controller and a head and neck sleeve. The near-infrared light enhances drainage of cerebrospinal fluid through a thermo-acoustic effect; magnetic stimulation induces multi-brain-region nerve rhythm resonance and cross rhythm coupling to improve the cognitive function; the controller controls the output parameters of the two stimuli and coordinates the frequency multiple relation and the phase difference of the two stimuli. The problems of single intervention mechanism and lack of space-time coordination in the prior art are solved, and bimodal multi-target combined regulation and control of metabolic clearance and nerve rhythm are realized. The system is suitable for auxiliary intervention of neurological diseases such as Alzheimer's disease and the like.
Owner:INST OF ELECTRICAL ENG CHINESE ACAD OF SCI

Acegastrodin derivative compound as well as preparation method and application thereof

The invention discloses an acegastrodin derivative compound with a chemical structural formula as shown in the specification, and the acegastrodin derivative compound has a protective effect on PC12 cell injury induced by H2O2 and can be used for preparing a neuroprotective preparation. The compound disclosed by the invention can be efficiently and sensitively combined with target protein so as to obtain potential target protein, a favorable tool can be provided for target research, potential targets of acegastrodin in treatment of neurological diseases can be explored, and the application of acegastrodin in treatment of neurological diseases can be promoted. The invention provides a new method for treating nerve diseases and ascertaining the mechanism of treating nerve diseases by acegastrodin. .
Owner:KUNMING UNIV OF SCI & TECH

Extended-release conjugates of lipidated peptides, and uses thereof

Provided herein are conjugates of lipidated peptides having release kinetics appropriate for at least monthly administration. Also provided are uses of such conjugates to treat metabolic or neurologic disease or disorder or associated symptoms in a subject in need thereof.
Owner:PROLYNX LLC

Use of postbiotics for treating or preventing disruptions of the gut-brain axis

Provided herein are postbiotic compositions prepared using fermentation and herbal substrate compositions for the treatment or prevention of the disruption of the gut-brain axis. Such postbiotic compositions can be used to treat or prevent neurological diseases or disorders, such as synucleinopathies, including but not limited to Parkinson's disease.
Owner:POSTBIOTICS PLUS RESEARCH LLC

Methods of using n-substituted indole neuroplastogens

PCT designated stageWO2026072561A1Organic active ingredientsNervous disorderPharmaceutical medicineMotor symptoms
The present invention relates to methods of treating diseases or disorders that are mediated by the loss of synaptic connectivity and / or plasticity, such as neurological diseases and disorders including obsessive compulsive disorder (OCD), Alzheimer's disease psychosis or psychosis in Alzheimer's disease (AD-P), frontotemporal dementia (FID), behavioral and psychological symptoms in dementia, motor symptoms in Parkinson's disease, and behavioral and psychological symptoms in Parkinson's disease, with (R)-1- (5-methoxy-1H-indol-1-y1)-N,N-dimethylpropan-2-amine (zalsupindole; AAZ-A-154). or a pharmaceutically acceptable salt or solvate thereof.
Owner:DELIX THERAPEUTICS INC

Salts and solid forms of 4-hydroxy-n,n-diisopropyltryptamine hemi-glutarate and hemi-succinate

Disclosed herein are salts and solid forms of 4-hydroxy-N,N-diisopropyltryptamine hemi-glutarate (4-OH-DIPT), e.g., 4-OH-DIPT hemi-glutarate, 4-OH-DIPT hemi-succinate, 4-OH-DIPT hemi-succinate hydrochloride, and 4-OH-DIPT hemi-glutarate hydrochloride. The solid form may be a salt and / or a crystalline form of the 4-OH-DIPT, such as a polymorph of 4-OH-DIPT or a salt thereof. Also disclosed are methods for making the solid forms and methods for administering the solid forms. The disclosed solid forms of 4-OH-DIPT are useful for treating neurological disease and / or a psychiatric disorder in a subject.
Owner:TERRAN BIOSCIENCES INC

Mesenchymal stem cell of membrane-bound neurotrophic factor GDNF as well as preparation method and application of mesenchymal stem cell

The invention discloses a mesenchymal stem cell of a membrane-bound neurotrophic factor (GDNF) as well as a preparation method and application of the mesenchymal stem cell. The preparation method comprises the following steps: firstly, connecting a ligand of a targeted MSC cell membrane to the surface of PEI, and meanwhile, wrapping a small annular DNA carrying a GDNF gene and a transmembrane domain fusion gene to form a nano-carrier; then designing and synthesizing sgRNA at a safe site in an MSC genome by utilizing a CRISPR-Cas9 system, and mixing the sgRNA with Cas9 protein to form an RNP compound; the preparation method comprises the following steps: preparing a nano-carrier, mixing the nano-carrier with an RNP compound, co-incubating with MSC cells, and finally co-culturing with a small molecular compound to obtain the mesenchymal stem cells of the membrane-bound neurotrophic factor GDNF. According to the method, the preparation efficiency and the cell performance are improved, and an effective way is provided for cell therapy of neurological diseases.
Owner:ZHONG LAI MEI KANG ZAI SHENG YI XUE KE JI (GUANG ZHOU) YOU XIAN GONG SI

Compositions and methods to treat neurological diseases

Disclosed is a method of treating a subject who has a neurological disease. The neurological disease may be associated with altered FOXG1 expression. In one aspect, the method includes a step of administering an effective dose of a FOXG1-AS antisense or inhibitory nucleic acid to a subject in need thereof, thereby rescuing the defects associated with altered FOXG1 expression.
Owner:RGT UNIV OF CALIFORNIA