Application of complement serine protease
A technology of serine protease and complement, applied in the field of molecular biology, can solve the problems such as no report of function, unresearched function and applicability of complement I factor or serine protease, no enlightenment, etc., and achieves the effect of simple preparation process.
Image
Examples
Embodiment 1
[0026] Preparation of Serine Protease Recombinant Protein of Complement Regulatory Protein I Factor (1) Construction of Serine Protease Expression Plasmid pEtPoCFI-Tryp The flounder complement serine protease of the present invention is obtained through a prokaryotic protein expression system, and its sequence is in the sequence table SEQ ID No.1 amino acid sequence.
[0027] The sequence listing SEQ ID No.1 is:
[0028] RVVGGVPAKPTQIQWQIALEENKKIDCGGAYIGGCWVLTAAHCVRPNPVPPFKVKFSLWRKWSAQDTTDIVPVEDIRIHPKYNAATYENDIALVKLEKLPFKDKCFEDNPAISAVCVPWSTQLFQANHTCSISGWGRTIDGRAAQVLLWANVSLIDNCQRFYKDRFRPGMMCAG
[0029] (a) Sequence features:
[0030] ●Length: 173
[0031] ●Type: amino acid sequence
[0032] ●Chain type: single chain
[0033] ●Topological structure: linear
[0034] (b) Molecule type: protein
[0035] (c) Assumption: No
[0036] (d) Antisense: no
[0037] (e) Original source: flounder cDNA was used as a template, PCR amplification was performed with primers F1 and R1, the...
Embodiment 2
[0044] Detection of the ability of the recombinant protein (rPoCFI-Tryp) containing serine protease to bind to various bacteria: different bacteria were inoculated in 5ml liquid LB medium and cultivated to OD 600About 0.8, among them, Edwardsiella tarda, Vibrio harveii, Vibrio anguillarum, and Pseudomonas fluorescens were cultured at 28°C; Escherichia coli, Micrococcus luteus, Staphylococcus aureus, and Bacillus subtilis were cultured at 37°C nourish;
[0045] Streptococcus iniae was inoculated in TSB medium and cultured at 28°C until OD 600 About 0.8.
[0046] Dilute each of the above bacteria to 10 with coating solution 8 CFU / ml, as bacterial diluent, dilute the protein purified in the above Example 1 in PBS to 2.5 μg / ml, 5 μg / ml, 10 μg / ml, 20 μg / ml, 40 μg / ml, 80 μg / ml, namely Diluent for rPoCFI-Tryp.
[0047] The above bacterial dilutions were mixed with dilutions of serine protease rPoCFI-Tryp or tagged protein rTrx (control group) at different concentrations, and CaCl...
Embodiment 3
[0051] Ability of Serine Protease rPoCFI-Tryp to Inhibit the Growth of Various Bacteria Step 1) Cultivation of Bacteria
[0052] Inoculate Edwardsiella tarda, Vibrio harveii, and Vibrio anguillaris in 5ml liquid LB respectively; inoculate Streptococcus iniae in TSB medium, and culture each strain in the respective medium to OD in a conventional manner 600 about 0.8, then dilute the culture solution to 10 with each new medium 6 CFU / ml. Step 2) Determine the growth curves of different bacteria
[0053] The protein purified in the above Example 1 was diluted to 70 μg / ml in PBS, which was the rPoCFI-Tryp dilution, and the above bacterial dilutions were mixed with the serine protease rPoCFI-Tryp dilution or the tagged protein rTrx (control group), and added Final concentration of 50 μM CaCl 2 , as for culturing in a 28°C incubator, the absorbance value was measured at 600nm every hour, and the growth curves of different bacteria were drawn (see figure 2 ). Depend on figure ...
PUM
Login to View More Abstract
Description
Claims
Application Information
- IPC
- A61K38/48; A61P31/04; C12N9/64; C12N15/70
- CPC
- A61K38/482; C12Y304/21106; C12N9/6405; C12N15/70; A61P31/04
- Inventors
- 李墨非; 贾贝贝


