Recombinant protein, test strip, preparation method and application for detecting 2019 novel coronavirus antibody by double antigen sandwich method
A double-antigen sandwich and coronavirus technology, applied in the direction of virus/bacteriophage, biochemical equipment and methods, viruses, etc., can solve the problems of large influence, unsatisfactory sensitivity, poor specificity, etc., and achieve high sensitivity, good stability, and easy operation easy effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0034] The present invention also provides a preparation method for the test strip described in the above technical scheme, comprising the following steps:
[0035] 1) Mix and couple the activated fluorescent microspheres with the recombinant protein described in the above technical scheme to obtain the multi-dominant epitope fusion protein of 2019 novel coronavirus labeled with fluorescent microspheres;
[0036] 2) spraying the 2019 novel coronavirus multi-dominant epitope fusion protein labeled with fluorescent microspheres onto the glass fiber membrane to obtain a fluorescent microsphere pad;
[0037] 3) Spray the 2019 novel coronavirus multi-dominant epitope fusion protein and the anti-N protein antibody on the detection area and the quality control area of the nitrocellulose membrane respectively to obtain a nitrocellulose membrane with the detection area and the quality control area fixed;
[0038] 4) Paste the sample absorbent pad, the fluorescent microsphere pad, the...
Embodiment 1
[0048] Preparation of reagent strips for detection of novel coronavirus 2019-nCoV antibody by double-antigen sandwich method.
[0049] 1. Preparation of novel coronavirus 2019-nCoV multi-dominant epitope fusion recombinant protein:
[0050] The dominant antigenic epitopes of the N protein, S protein, and M protein of the new coronavirus 2019-nCoV were screened by computational prediction, and linked together by a flexible polypeptide (GGGS) to form a 2019-nCoV virus multi-dominant epitope fusion protein, amino acid sequence As shown in the sequence SEQ ID NO.1. Entrusted Beijing Deaoping Biotechnology Co., Ltd. to produce and prepare, the purity is greater than 95%.
[0051] DQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQ GGGS DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGNTSNQVAVLYQDVNCTEVPVAIHA GGGS TLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[0052] 2. Preparation ...
Embodiment 2
[0064] Application of double-antigen sandwich method for detection of novel coronavirus 2019-nCoV antibody test strips
[0065] 1. Sample pretreatment
[0066] Aspirate 20 μL whole blood sample and add to 200 μL sample diluent, mix thoroughly.
[0067] 2. Test with test strips
[0068] Use a micropipette to accurately draw 80 μL of the sample solution to be tested into the sample hole of the test strip, and act for 15 minutes at room temperature (20-25°C); insert the test paper card into the carrier of the fluorescence detector, and select the sample to be tested through the touch screen. item, press the "Start Detection" button, the fluorescence detector will automatically scan the test paper card; read or print the test results on the display screen of the instrument.
[0069] 3. Analysis of test results
[0070] Quantitative detection
[0071] After the test is completed, the instrument obtains the ratio of the time-resolved fluorescence intensity of the detection area ...
PUM
Property | Measurement | Unit |
---|---|---|
diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com