Rice SBP-box transcription factor genes and application thereof

A technology of transcription factor and sbp-box, applied in the field of plant bioengineering and plant improvement genetic engineering

Active Publication Date: 2015-03-25
FUJIAN AGRI & FORESTRY UNIV
View PDF4 Cites 14 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, since many transcription factors are involved in the complex process of plant stress response, the transcription factors found to be involved in the expression of stress resp...

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Rice SBP-box transcription factor genes and application thereof
  • Rice SBP-box transcription factor genes and application thereof
  • Rice SBP-box transcription factor genes and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0099] Example 1: SST rice transgenic experiment

[0100] 1. High salt tolerance sst Mutant acquisition and traits

[0101] A rice mutant library containing about 1000 lines was constructed by treating rice seeds with gamma rays. Large-scale screening of the rice mutant library under the salt stress of 150 mM sodium chloride concentration, after repeated verification of the candidate mutants under the salt stress of 150 mM sodium chloride concentration, observation of salt-tolerant phenotypes, and obtaining a performance height salt-tolerant mutant sst .

[0102] with molecular markers SST The gene was initially located on the sixth chromosome of rice. use sst Mutants crossed with salt-sensitive varieties to construct large-scale F 2 Group, using molecular markers to screen the exchanged individuals from the population, combined with the genotype and phenotype of the exchanged individuals, carried out map-based cloning, and successfully cloned SS...

Embodiment 2

[0113] Embodiment 2: Cultivation and salt stress test of transgenic plants

[0114] The seeds of the transgenic rice obtained in Example 1 were taken, and after dormancy was broken in an oven at 45°C for one week, they were sown in petri dishes, soaked in tap water at room temperature for 2 days, and accelerated germination at 37°C for 1 day. After germination, move them into a light incubator, cultivate at 28°C, and light for 11 hours a day. After 1 day, the temperature was gradually lowered to 26°C for another day. After the seedlings are basically out, the tap water is replaced with rice culture medium for cultivation.

[0115] Test results such as figure 1 and figure 2 shown. Such as figure 1 As shown, the rice mutant sst Compared with the wild type (R401), the salt tolerance was significantly improved.

[0116] Depend on figure 2 Visible: the wild-type (R401) SST Genome fragments are transferred by transgene sst Among the mutants, the transge...

Embodiment 3

[0118] Example 3. In different plants SST presence of homologous genes

[0119] A database search (http: / / www.ncbi.nlm.nih.gov / ) found that in Oryza short-anthers ( Oryza brachyantha ), millet ( Setaria italica ), sorghum ( Sorghum bicolor ),wheat( Triticum aestivum ),corn( Zea mays ),barley( Hordeum vulgare ), Urartu Wheat ( Triticum urartu ), Brachypodium distachydium ( Brachypodium distachyon ), Festival wheat ( Aegilops tauschii ) and other genomes have homologous genes. The similarity of proteins ranged from 81.2% to 56.5%.

[0120] These homologous genes all have a conserved SBP domain with high similarity. The sequence is RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHN (positions 180-249 of SEQ ID NO.2). The SBP-box transcription factor protein is combined by the SBP domain and the cis-acting element, so these homologous genes have a corresponding relationship with the cis-acting element, which indicates that othe...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention provides rice SBP-box transcription factor genes and application thereof. The rice SBP-box transcription factor genes comprise SEQ ID No.1 nucleotide sequences and SEQ ID No. 2 amino acid sequences, coding sequences with the transcription factors and carriers or hosts containing the coding sequences. The invention further relates to a method of improving salt resistance of plants and a method of choosing plants with high salt resistance. The invention provides a new method of improving and searching salt resistance of plants; and the new method has wide application prospects.

Description

technical field [0001] The invention relates to the fields of plant bioengineering and plant improvement genetic engineering. Specifically, the present invention relates to the application of the rice SBP-box protein transcription factor gene and its encoded protein or polypeptide in enhancing plant salt tolerance, and improving the plant's resistance to salt stress by inhibiting the gene or its expressed protein. Methods of resistance and transgenic plants. Background technique [0002] The increase in global food demand and the continuous reduction of arable land have created continuous pressure on food security in all countries. In food production, salinity-alkali is the main abiotic stress, which causes a large reduction in crop yield and quality every year. [0003] According to some data, the salinization of China's farmland is also one of the main reasons for the reduction and low yield. Salinity has become a serious problem in my country's agriculture. [000...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
IPC IPC(8): C12N15/29C07K14/415C12N15/82A01H5/00C12Q1/68
Inventor 兰涛吴为人张淑君汪斌刘婷婷林格格官华忠
Owner FUJIAN AGRI & FORESTRY UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap