A rice sbp-box transcription factor gene and its application

A technology of transcription factor and sbp-box, applied in the field of plant bioengineering and plant improvement genetic engineering

Active Publication Date: 2017-07-07
FUJIAN AGRI & FORESTRY UNIV
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, since many transcription factors are involved in the complex process of plant stress response, the transcription factors found to be involved in the expression of stress response genes are only a small part, and there are still a large number of transcription factors to be discovered and studied, and further applied to crop stress resistance molecular breeding

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A rice sbp-box transcription factor gene and its application
  • A rice sbp-box transcription factor gene and its application
  • A rice sbp-box transcription factor gene and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0099] Example 1: SST rice transgenic experiment

[0100] 1. High salt tolerance sst Mutant acquisition and traits

[0101] A rice mutant library containing about 1000 lines was constructed by treating rice seeds with gamma rays. Large-scale screening of the rice mutant library under the salt stress of 150 mM sodium chloride concentration, after repeated verification of the candidate mutants under the salt stress of 150 mM sodium chloride concentration, observation of salt-tolerant phenotypes, and obtaining a performance height salt-tolerant mutant sst .

[0102] with molecular markers SST The gene was initially located on the sixth chromosome of rice. use sst Mutants crossed with salt-sensitive varieties to construct large-scale F 2 Group, using molecular markers to screen the exchanged individuals from the population, combined with the genotype and phenotype of the exchanged individuals, carried out map-based cloning, and successfully cloned SST Gene. Should ...

Embodiment 2

[0113] Embodiment 2: Cultivation and salt stress test of transgenic plants

[0114] The seeds of the transgenic rice obtained in Example 1 were taken, and after dormancy was broken in an oven at 45°C for one week, they were sown in petri dishes, soaked in tap water at room temperature for 2 days, and accelerated germination at 37°C for 1 day. After germination, move them into a light incubator, cultivate at 28°C, and light for 11 hours a day. After 1 day, the temperature was gradually lowered to 26°C for another day. After the seedlings are basically out, the tap water is replaced with rice culture medium for cultivation.

[0115] Test results such as figure 1 with figure 2 shown. Such as figure 1 As shown, the rice mutant sst Compared with the wild type (R401), the salt tolerance was significantly improved.

[0116] Depend on figure 2 Visible: the wild-type (R401) SST Genome fragments are transferred by transgene sst Among the mutants, the transgenic complem...

Embodiment 3

[0118] Example 3. In different plants SST presence of homologous genes

[0119] A database search (http: / / www.ncbi.nlm.nih.gov / ) found that in Oryza short-anthers ( Oryza brachyantha ), millet ( Setaria italica ), sorghum ( Sorghum bicolor ),wheat( Triticum aestivum ),corn( Zea mays ),barley( Hordeum vulgare ), Urartu Wheat ( Triticum urartu ), Brachypodium distachydium ( Brachypodium distachyon ), Festival wheat ( Aegilops tauschii ) and other genomes have homologous genes. The similarity of proteins ranged from 81.2% to 56.5%.

[0120] These homologous genes all have a conserved SBP domain with high similarity. The sequence is RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHN (positions 180-249 of SEQ ID NO.2). The SBP-box transcription factor protein is combined by the SBP domain and the cis-acting element, so these homologous genes have a corresponding relationship with the cis-acting element, which indicates that other grass c...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention provides rice SBP-box transcription factor gene and application thereof. The present invention specifically relates to the coding sequence comprising the nucleotide sequence of SEQ ID NO.1 and the amino acid sequence of SEQ ID NO.2; the transcription factor and the vector or host containing the coding sequence. The invention also relates to a method for improving salt tolerance of plants and a method for screening plants with high salt tolerance. The invention provides a new method for improving and studying the salt tolerance of plants, and has broad application prospects.

Description

technical field [0001] The invention relates to the fields of plant bioengineering and plant improvement genetic engineering. Specifically, the present invention relates to the application of the rice SBP-box protein transcription factor gene and its encoded protein or polypeptide in enhancing plant salt tolerance, and improving the plant's resistance to salt stress by inhibiting the gene or its expressed protein. Methods of resistance and transgenic plants. Background technique [0002] The increase in global food demand and the continuous reduction of arable land have created continuous pressure on food security in all countries. In food production, salinity-alkali is the main abiotic stress, which causes a large reduction in crop yield and quality every year. [0003] According to some data, the salinization of China's farmland is also one of the main reasons for the reduction and low yield. Salinity has become a serious problem in my country's agriculture. [0004] T...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/29C07K14/415C12N15/82A01H5/00C12Q1/68
Inventor 兰涛吴为人张淑君汪斌刘婷婷林格格官华忠
Owner FUJIAN AGRI & FORESTRY UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap