Recombinant brevibacillus brevis expressing pig growth hormone gene, construction method and application
A technology of Bacillus brevis and growth hormone, which is applied in the field of recombinant Bacillus brevis expressing porcine growth hormone gene and its construction and application, can solve the problems of short half-life of growth hormone and achieve the effect of short half-life
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0030] Acquisition of porcine growth hormone gene
[0031] The porcine growth hormone sequence (AAA31045) published on NCBI is shown in sequence 1 in the sequence table, optimized according to the codon preference of Bacillus brevis, the nucleotide sequence of 6 histidines is added upstream, and the stop codon is added downstream XbaI and ClaI restriction sites and protective bases were added at both ends, and the sequence was artificially synthesized. See sequence 2 in the sequence table.
[0032] Sequence 1
[0033] FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTYLRSDDALLKGLLSFKKDLHKAETNLRSDDALLKGLLSFKKDLHKAETNLRSDDALLKGLLSFKKDLHK
[0034] Sequence 2
[0035] GCTCTAGACATCATCATCATCATCATTTCCCGGCAATGCCGCTGAGCAGCCTGTTCGCGAACGCGGTGCTGCGCGCGCAACACCTGCACCAGCTGGCGGCAGATACGTATAAAGAATTCGAACGCGCGTACATCCCGGAAGGCCAACGCTATAGCATCCAGAACGCGCAAGCGGCGTTCTGCTTCAGCGAGACGATCCCGGCGCCGACGGGCAAAGATGAAGCGCAACAGC...
Embodiment 2
[0037] Construction of the recombinant plasmid pGH-pNCM02 of Bacillus brevis
[0038] 1. Double enzyme digestion reaction of pGH gene and pNCM02 plasmid
[0039] Use restriction enzymes XbaI and ClaI to double digest the gene and pNCM02 plasmid obtained in Example 1. The double digestion reaction system is as follows:
[0040] system Volume (μL) XbaI2 ClaI2 pGH gene / pNCM02 plasmid20 10×M buffer4 ddH2O12 total capacity40
[0041] After reacting in a 37°C incubator for 3 hours, the agarose gel recovered the double digested fragments.
[0042] 2. The ligation reaction between pGH gene and pNCM02 plasmid
[0043] T4 ligase ligation reaction system is as follows:
[0044] system Volume (μL) pGH8 pNCM028 T42 10×buffer2 total capacity20
[0045] React overnight in a refrigerator at 4°C.
[0046] 3. The ligation product transforms JM109 E. coli competent cells
[0047] 3.1. Take out the E. coli JM109 competent cells (100μL) frozen at -80°C, hold them in the palm of your hand for...
Embodiment 3
[0061] Construction of Recombinant Bacillus brevis
[0062] 1. Preparation of relevant media and reagents
[0063] T2 liquid medium: glucose 1.0%, peptone 1.0%, beef extract 0.5%, yeast extract 0.2%, pH 7.0; T2 solid medium is T2 liquid medium supplemented with 2% agar powder.
[0064] Competent preparation medium: T2 medium is supplemented with MnSO4 0.001% (w / v, the same below), FeSO40.0001%, ZnSO4 0.0001%
[0065] Competent washing solution 1: sucrose 10%, HEPES 16mM, CaCl2 1mM, glycerol 15%, pH 7.0.
[0066] Competent washing solution 2: PEG6000 15%, HEPES 1mM, pH 7.0.
[0067] Repair medium: add 20mM MgCl2 to T2 liquid medium
[0068] 2. Preparation of Bacillus brevis SP3 Competent
[0069] 2.1. Resuscitate Bacillus brevis SP3 by streaking on a T2 solid medium plate, and culture it upside down at 37°C18;
[0070] 2.2. Cultivation seed solution: Pick a single colony of Bacillus brevis SP3 and inoculate it in 5ml T2 liquid medium, and cultivate overnight at 30°C and 250rpm.
[0071] 2.3. ...
PUM
Property | Measurement | Unit |
---|---|---|
molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com