Taq DNA polymerase mutant, PCR reaction reagent and kit
A polymerase and mutant technology, applied in the direction of enzymes, applications, transferases, etc., can solve problems such as confusion, increased reagent costs and time costs, and cross-contaminated samples
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0071] This embodiment provides a Taq DNA polymerase mutant whose amino acid sequence is shown in SEQ ID NO.25.
[0072] The present embodiment also provides the preparation method of above-mentioned Taq DNA polymerase mutant, it comprises the following steps:
[0073] (1) Sequence optimization is carried out to synthesize the gene fragment of the Taq DNA polymerase mutant (identical to the nucleotide sequence shown in the 1-2496th position in SEQ ID NO.27), and the group is added at the 3' end of the gene fragment Amino acid tag (shown as positions 2695-2724 in SEQ ID NO.27).
[0074] (2) Ligate the nucleotide fragment obtained in step (1) into the gene expression vector pET-28a to construct a recombinant plasmid.
[0075] (3) Transforming the recombinant plasmid into the host cell, ie Escherichia coli competent cell E. coli BL21(DE3), to obtain the recombinant cell.
[0076] (4) Induce the expression of the recombinant cells in step (3), and collect the thalline; the speci...
Embodiment 2
[0090]This embodiment provides a Taq DNA polymerase mutant complex, which is formed by fusion of the Taq DNA polymerase mutant in Example 1 and the DNA binding protein of SEQ ID NO.26.
[0091] SEQ ID NO.26:
[0092] MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK.
[0093] The Taq DNA polymerase mutant complex adopts the nucleotide sequence shown in SEQ ID NO.27 (the underline is a histidine tag, and the nucleotide sequence encoding the DNA binding protein shown in SEQ ID NO.26 is the 2497-2694th position ), prepared with reference to the method of Example 1. Adjust the concentration of the complex to the appropriate concentration using the enzyme stock solution. Wherein, the enzyme storage solution contains: 20mM Tris-HCl (pH 8.0), 100mM KCl, 1mM dithiothreitol and 40% glycerol.
[0094] SEQ ID NO.27:
[0095] atgcgtggtatgttacgattatttgaaccaaaaggtcgtgttttattggttgatggtcatcatctggcctatcgtacctttcatgcactgaagggattgacaacctcccgtggcgaacgcgtccaggcagtgtatggattcgca...
Embodiment 3
[0097] This embodiment provides another Taq DNA polymerase mutant complex, which is formed by antigen-antibody reaction between the Taq DNA polymerase mutant in Example 1 and the nanobody against the Taq DNA polymerase mutant.
[0098] The preparation method of the above nanobody can refer to the following steps:
[0099] (a) Take an appropriate amount of the Taq DNA polymerase mutant obtained in Example 1 as an antigen, and add an adjuvant. In this example, Fisher's adjuvant is used to immunize alpacas that can produce nanobodies. Stop immunization when the antibody production is stable. Blood collection, using affinity chromatography or adsorbent method to separate the antiserum, after measuring the specificity and titer of the antiserum, separating and purifying the antiserum to obtain the anti-Taq DNA polymerase mutant nanobody;
[0100] (b) Preparation of antigen-antibody complex: the anti-Taq DNA polymerase mutant nanobody obtained in the step (a) of the anti-Taq DNA pol...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


