Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

92results about "Pregnancy proteins" patented technology

Metal-binding compounds and uses therefor

The invention provides a method of reducing the damage done by reactive oxygen species (ROS) in an animal. The invention also provides a method of reducing the concentration of a metal in an animal. These methods comprise administering to the animal an effective amount of a metal-binding compound as further described in the application. The invention further provides a method of reducing the damage done by ROS to a cell, a tissue or an organ that has been removed from an animal. This method comprising contacting the cell, tissue or organ with a solution or medium containing an effective amount of a metal-binding compound of the invention. The invention further provides novel metal-binding compounds, pharmaceutical compositions comprising the metal-binding compounds, and kits comprising a container holding a metal-binding compound of the invention.
Owner:AMPIO PHARMA

New assays for preimplantation factor and preimplantation factor peptides

InactiveUS20050064520A1High expressionReduce cell viabilityBiological material analysisBiological testingPIF peptideFluorescence
The present invention relates to assay methods used for detecting the presence of PIF, and to PIF peptides identified using this assay. In particular, the present invention relates to flow cytomery assays for detecting PIF. It is based, at least in part, on the observation that flow cytometry using fluorescently labeled antilymphocyte and anti-platelet antibodies demonstrated an increase in rosette formation in the presence of PIF. It is further based on the observation that flow cytometry demonstrated that monoclonal antibody binding to CD2 decreased in the presence of PIF. The present invention further relates to PIF peptides which, when added to Jurkat cell cultures, have been observed to either (I) decrease binding of anti-CD2 antibody to Jurkat cells; (ii) increase expression of CD2 in Jurkat cells; or (iii) decrease Jurkat cell viability. In additional embodiments, the present invention provides for ELISA assays which detect PIF by determining the effect of a test sample on the binding of anti-CD2 antibody to a CD2 substrate.
Owner:BIOLNCEPT INC

Inflammation-Inhibitory Serum Factors and Uses Thereof

Disclosed are methods of purifying compounds that reduce or prevent an inflammatory response in a mammal, use of such compounds in treating a mammal having or being at risk of developing inflammation, as well as serum containing such purified compounds. Also disclosed are animal models that are more representative of humans in the study of inflammatory responses or as screening tools for discovering or developing new therapeutics or lead candidate compounds for inhibition of an inflammatory response.
Owner:THE GENERAL HOSPITAL CORP +1

Assays for preimplantation factor and preimplantation factor peptides

The present invention relates to assay methods used for detecting the presence of PIF, and to PIF peptides identified using this assay. In particular, the present invention relates to flow cytomery assays for detecting PIF. It is based, at least in part, on the observation that flow cytometry using fluorescently labeled antilymphocyte and anti-platelet antibodies demonstrated an increase in rosette formation in the presence of PIF. It is further based on the observation that flow cytometry demonstrated that monoclonal antibody binding to CD2 decreased in the presence of PIF. The present invention further relates to PIF peptides which, when added to Jurkat cell cultures, have been observed to either (I) decrease binding of anti-CD2 antibody to Jurkat cells; (ii) increase expression of CD2 in Jurkat cells; or (iii) decrease Jurkat cell viability. In additional embodiments, the present invention provides for ELISA assays which detect PIF by determining the effect of a test sample on the binding of anti-CD2 antibody to a CD2 substrate.
Owner:BIOLNCEPT INC

pH-responsive magnetic metal organic framework composite nano-material and its preparation method and use

The invention discloses a pH-responsive magnetic metal organic framework composite nano-material and its preparation method and use. The pH-responsive magnetic metal organic framework composite nano-material comprises Fe3O4 nanoparticles, polymer layers coating the surfaces of the Fe3O4 nanoparticles and a metal organic framework growing on the polymer layers. The polymer layer comprises a first polymer chelated with metal ions or comprises the first polymer chelated with metal ions and a hydrophilic second polymer. The metal organic framework is formed from Fe<3+> and a phenylboronic acid derivative containing at least one carboxyl group or at least two boronic acid groups through a coordination bond. The composite nano-material provided by the invention has good magnetic response performances and can realize reversible and highly selective capture and release of glycoprotein in different pH environments, and the pH environment is relatively mild so that the influence on the glycoprotein activity is avoided.
Owner:SICHUAN UNIV

Metal-binding compounds and uses therefor

The invention provides a method of reducing the damage done by reactive oxygen species (ROS) in an animal. The invention also provides a method of reducing the concentration of a metal in an animal. These methods comprise administering to the animal an effective amount of a metal-binding compound as further described in the application. The invention further provides a method of reducing the damage done by ROS to a cell, a tissue or an organ that has been removed from an animal. This method comprising contacting the cell, tissue or organ with a solution or medium containing an effective amount of a metal-binding compound of the invention. The invention further provides novel metal-binding compounds, pharmaceutical compositions comprising the metal-binding compounds, and kits comprising a container holding a metal-binding compound of the invention.
Owner:AMPIO PHARMA

Method for separating purified immuno regulation active polypeptide from placenta of cattle

InactiveCN1687107AMeet the needs of different industriesAbundant raw materialsPeptide/protein ingredientsMammal material medical ingredientsUltrafiltrationHeifer calf
The present invention provides a new placenta resource-bovine placanta, and adopts the processes of cleaning cutting into block, homogenization, extraction, centrifugal precipitation separation, ultrafiltration of supernatant fluid, nano-fitlering to remove salt and freeze-drying so as to obtain the basic product containing active immuno regulatory activity polypeptide, then making said basic product undergo the processes of separation and purification by means of anion-exchange chromatography, gel exclusion chromatography and inversed phase high-performance liquid chromatography and freeze-drying so as to obtain the purified product.
Owner:浙江三鹿实业有限公司

Alpha-fetoprotein peptides and uses thereof

Therapeutic compounds which are cell proliferation modulators, preferably inhibitors. These modulators contain amino acid structures that are arranged as a hydrophilic analog of an alpha-fetoprotein. The modulator may be a peptide itself, e.g., an octapeptide like that of SEQ ID NO: 5; a peptidomimetic; or may be in the form of a pharmaceutically acceptable scaffold, such as a polycyclic hydrocarbon to which is attached the necessary amino acid structures for biological and / or chemical activity. The modulators of the invention are distinguished in one aspect over previous compounds in that they are orally active, and therefore do not have to be injected into the patient. The compositions and methods are useful for reducing estrogen-stimulated growth of cells, and treating or preventing cancer, such as breast cancer. The treatment or prevention methods can include the use of tamoxifen therapy in combination with the peptide therapy.
Owner:ALBANY MEDICAL COLLEGE

Metal-binding compounds and uses therefor

The invention provides a method of reducing the damage done by reactive oxygen species (ROS) in an animal. The invention also provides a method of reducing the concentration of a metal in an animal. These methods comprise administering to the animal an effective amount of a metal-binding compound as further described in the application. The invention further provides a method of reducing the damage done by ROS to a cell, a tissue or an organ that has been removed from an animal. This method comprising contacting the cell, tissue or organ with a solution or medium containing an effective amount of a metal-binding compound of the invention. The invention further provides novel metal-binding compounds, pharmaceutical compositions comprising the metal-binding compounds, and kits comprising a container holding a metal-binding compound of the invention.
Owner:AMPIO PHARMA

Milk caw PAG1 (Pregnancy-associated glycoprotein 1) polypeptide, and polyclonal antibody and application thereof

The invention relates to a milk caw PAG1 (Pregnancy-associated glycoprotein 1) polypeptide and a polyclonal antibody of the polypeptide. The amino acid sequence of the milk caw PAG1 polypeptide is Asn Asn Ile His Arg Leu Ile Gly Ala Ile Pro Arg Gly Ser Glu His Tyr Val Pro Cys Ser Glu Val Asn Thr. The polypeptide and a carrier protein are crosslinked and are then used for immunizing animals; the immunized animal blood is collected for preparing antiserum; separation and purification are performed to obtain the polyclonal antibody. The antibody is applied to milk caw pregnancy detection, and has the advantages of high specificity, high valence and great application prospects.
Owner:SHANXI AGRI UNIV

Use of rAFP inhibit or prevent apoptosis

InactiveUS20050203023A1BiocideNervous disorderApoptosisFeta cheese
A method of inhibiting apoptosis in a cell by administering to the cell an apoptosis inhibiting amount of recombinant human alpha-feta protein or an apoptosis-inhibiting fragment thereof.
Owner:MERRIMACK PHARMACEUTICALS INC

Marker for prolonged rupture of membranes

The present invention relates to amniotic fluid specific polypeptide and a method for detecting rupture of the amniotic membranes. In particular the invention provides a marker for prolonged rupture of the membranes (PROM), which marker consists essentially of polypeptides of approximately 75 kDa, 20 kDa and 50 kDa as determined by 4-15% gradient SDS-PAGE under reducing conditions.
Owner:SWISS ASIAN PROPERTY

Marker for prolonged rupture of membranes

The present invention relates to amniotic fluid specific polypeptide and a method for detecting rupture of the amniotic membranes. In particular the invention provides a marker for prolonged rupture of the membranes (PROM), which marker consists essentially of polypeptides of approximately 75 kDa, 20 kDa and 50 kDa as determined by 4-15% gradient SDS-PAGE under reducing conditions.
Owner:SWISS ASIAN PROPERTY

Recombinant plasmid, recombinant malaria parasite and its application

ActiveCN106687592AConducive to long-term existenceFacilitated releaseTumor rejection antigen precursorsProtozoaBacteroidesMalaria
The present invention relates to the field of cellular immunotherapy for tumors and, more particularly, to a recombinant plasmid for the construction of recombinant malaria parasites and their use, wherein the recombinant plasmid is a tumorigenin-specific antigen gene inserted into the pL0017 plasmid, Recombinant malaria parasite, comprising the recombinant plasmid. Compared with plasmid DNA and RNA vector, the recombinant malaria parasite can be multiplied by the proliferation of Plasmodium, which is beneficial to the increase of the antigen in vivo. Compared with the defective virus and bacterial carrier, it survives in the red blood cells of the body longer, not short-term by the body's immune system to clear, long-term effective expression of exogenous tumor antigen, is conducive to long-term antigen and immune stimulation. The recombinant malaria parasite is capable of activating the high expression of Th1-related cytokines in vivo and increasing the proportion of CD8a + DCs in total CD11c + DCs and further activating specific cytotoxic T lymphocyte responses against tumor antigens, which is beneficial to the antitumor effect of the vaccine.
Owner:BLUE ELEGANT BIOTECH CO LTD

Alpha-fetoprotein peptides and uses thereof

ActiveUS20080039403A1Improve efficacyGrowth inhibitionTetrapeptide ingredientsPeptide sourcesEstrogen receptorAlpha-fetoprotein
The invention relates to compounds that include peptide and peptidomimetics that inhibit estrogen receptor dependent cell proliferation. The compounds of the invention are useful for treating cell proliferative disorders or physiological conditions characterized by undesirable or unwanted estrogen induced cell proliferation, including breast cancer.
Owner:ALBANY MEDICAL COLLEGE

Composition and system for separating and detecting alpha-fetoprotein variant and use thereof

ActiveUS20180009863A1Detection is fast and convenientThe result is accuratePeptide/protein ingredientsComponent separationAlpha-fetoproteinBiology
Disclosed are a composition and system for separating and detecting an alpha-fetoprotein variant, comprising a separation reagent and a detection reagent; a system for separating and detecting an alpha-fetoprotein variant and a use thereof; and a kit for separating and detecting the alpha-fetoprotein variant. By means of the composition and system for separating and detecting the alpha-fetoprotein variant, and the use thereof, primary liver cancer can be indicated early on, the sensitivity is high, and the method is rapid, simple and automated.
Owner:BEIJING HOTGEN BIOTECH CO LTD

Application of DKK1 as diagnostic marker

InactiveCN103487580AMicrobiological testing/measurementBiological material analysisTrue positive rateDKK1
The invention discloses an application of DDK1 as a diagnostic marker. Through analysis of a large amount of hepatocellular carcinoma samples, the inventor analyzes the expressions of DKK1 and AFP, firstly discovers that serum DKK1 has a high sensitivity and specificity on diagnosis of hepatocellular carcinoma, especially diagnosis of alpha fetal protein negative hepatocellular carcinoma, identification of hepatocellular carcinoma and alpha fetal protein positive chronic liver disease, and / or diagnosis of hepatocellular carcinoma in the early stage or small hepatocellular carcinoma, and more especially the precision of clinical diagnosis can be largely increased by DKK1-AFP combined diagnosis.
Owner:SHANGHAI INST OF ONCOLOGY

Method for preparing human pregnancy-specific glycoprotein 9

The invention relates to a method for preparing human pregnancy-specific glycoprotein 9. The method comprises the following steps: (1) construction of a recombinant strain, i.e. transferring encoding gene of human PSG9 protein into a host escherichia coli to obtain the recombinant strain; (2) induction culture of the recombinant strain, i.e. conducting induction culture of the recombinant strain at the temperature of 30 DEG C by using IPTG of which the concentration in a bacterial liquid is 3mu M to obtain induced thalli; and (3) protein purification: i.e. breaking up the induced thalli to take the supernatant which is then purified by using a nickel column with elution buffer containing 40nM imidazole as the eluent, and collecting the eluent to obtain the human PSG 9 protein. Experiment results show that the human PSG 9 prepared according to the method has high purity which can reach 27.3mg / L, thereby laying a foundation for subsequent research of action mechanism of PSG 9 in cancers and obtaining of a high-purity monoclonal antibody.
Owner:BEIJING CHAOYANG HOSPITAL CAPITAL MEDICAL UNIV

Method for Isolating and Purifying Immuno-Modulating Polypeptide from Cow Placenta

The present invention provides a method for isolating and purifying immuno-modulating polypeptide from cow placenta, which is characterized by using the steps of anion-exchange chromatography, gel exclusion chromatography and reverse-phase high performance liquid chromatography to isolate and purify immuno-modulating polypeptide from cow placenta, identifying its activity of stimulating lymphocyte proliferation in vitro by MTT method, then determining its molecular weight by MALDI-TOF-MS, its isoelectric point by CIEF and its amino acid sequence with analyzer for protein sequencing. Since the obtained immuno-modulating polypeptide by the method according to the present invention has more than 90% purity, its bioactivity can reach medicinal standards.
Owner:SHI JIA ZHUANG SANLU GRP

Constructs targeting afp peptide/mhc complexes and uses thereof

The present application provides constructs comprising an antibody moiety that specifically binds to a complex comprising an AFP peptide and an MHC class I protein. Also provided are methods of making and using these constructs.
Owner:EUREKA THERAPEUTICS INC

Alpha-fetoprotein peptides and uses thereof

ActiveUS7598342B2Tetrapeptide ingredientsPeptide sourcesAlpha-fetoproteinEstrogen receptor
The invention relates to compounds that include peptide and peptidomimetics that inhibit estrogen receptor dependent cell proliferation. The compounds of the invention are useful for treating cell proliferative disorders or physiological conditions characterized by undesirable or unwanted estrogen induced cell proliferation, including breast cancer.
Owner:ALBANY MEDICAL COLLEGE

Angiogenesis-inhibiting peptide and application thereof

InactiveUS20130172258A1Inhibit angiogenesisInhibiting endothelial cell proliferationSenses disorderPeptide/protein ingredientsPlacenta Growth FactorAngiogenesis growth factor
Provided is a polypeptide having angiogenesis inhibiting activity. The polypeptide is derived from Placenta Growth Factor-1. Also provided are a derivative polypeptide of the polypeptide, a preparation method for polypeptide, and a pharmaceutical composition containing the polypeptide.
Owner:SHANGHAI FIRST PEOPLES HOSPITAL

Antagonists to chaperonin 10

Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.
Owner:QUEENSLAND UNIV OF THE

Methods for early detection of pregnancy in cows

ActiveUS7604950B2Peptide/protein ingredientsMicrobiological testing/measurementProgesterone levelProgesterones
Disclosed are methods for determining the pregnancy status of a cow by detecting a pregnancy-associated glycoprotein (PAG) level that comprises proteins present in an acidic protein fraction of day 55 to day 60 bovine placental tissue. These methods may involve using novel polyclonal and monoclonal antibodies that have been generated using the acidic protein fraction as an immunogen. According to the method, the cow is pregnant when the PAG level is present at an elevated level in a sample obtained from the cow. The invention provides accurate methods of detecting pregnancy at early stages and has the benefit of allowing early post partum detection of pregnancy status with few false positive results. The antibodies for detecting the PAG level will also be useful in combination with detecting elevated progesterone levels, thus providing an even more effective pregnancy detection method. The benefit of this early pregnancy detection is that identifying cows that are not pregnant very shortly after breeding allows for timely rebreeding and minimizes the amount of time the cow is open. Also disclosed are methods for making a breeding decision for a cow. These methods allow a herd manager to make breeding decisions based on the PAG level and optionally, progesterone levels, detected in a biological sample taken from a cow suspected of being in the early stages of pregnancy.
Owner:MONSANTO TECH LLC

Thymus-dependent lymphocyte antigen epitope peptides of primary liver cancer related antigens and application thereof

The invention belongs to the field of medical immunology and oncology and discloses thymus-dependent lymphocyte antigen epitope peptides of primary liver cancer related antigens and application thereof. The antigen epitope peptides are antigen peptides separately restricted by HLA-A0201, HLA-A1101, hLA-A2402, HLA-A3101, HLA-A0206, HLA-A0207, HLA-A3303, HLA-A3001, HLA-A0203, HLA-A1102, HLA-A0301, HLA-A0101 and HLA-A2601 molecules, and the varieties of the antigen epitope peptides sum to 110. The antigen epitope peptides can specifically bind to cytotoxic thymus-dependent lymphocytes so as to stimulate the activation, proliferation and differentiation of the thymus-dependent lymphocytes, so anti-tumor immune effect is exerted; the antigen peptides can be used for preparing therapeutic and preventive vaccines for liver cancer, can also be used for preparing detection reagents for detecting liver cancer-related antigen-specific cytotoxic thymus-dependent lymphocytes, and have potential application value in prevention, treatment and diagnosis of liver cancer.
Owner:南京大户生物科技有限公司 +1

Alpha-fetoprotein peptides

ActiveUS20090203624A1Peptide/protein ingredientsMetabolism disorderEstrogen receptorAlpha-fetoprotein
The invention relates to compounds that include peptides that inhibit estrogen receptor dependent cell proliferation. The compounds of the invention are useful for treating cell proliferative disorders or physiological conditions characterized by undesirable or unwanted estrogen induced cell proliferation, including breast cancer.
Owner:ALBANY MEDICAL COLLEGE

Enriched Pag-55 Fraction and Methods for Early Detection of Preganancy in Ungulate Animals

ActiveUS20080003695A1Peptide/protein ingredientsMicrobiological testing/measurementElevated progesteroneProgesterone level
Disclosed are methods for determining the pregnancy status of an ungulate animal by detecting the level of PAG-55 protein fraction. These methods may involve the detection of PAG-55 enriched proteins in the PAG-55 protein fraction by using novel polyclonal and monoclonal antibodies that have been generated using the PAG-55 enriched protein fraction as an immulogen. The novel PAG-55 protein fraction indicates that the animal is pregnant when the acidic PAG-55 protein fraction, or antigenic components thereof, are present at an elevated level in a sample. The present invention also provides for methods of obtaining the PAG-55 enriched protein fraction. The invention provides accurate methods of detecting pregnancy at early stages and has the benefit of allowing early post partum detection of the pregnancy status with few1 false positive results. The antibodies for detecting PAG-55 proteins will also be useful in combination with detecting elevated progesterone levels in the animal, thus providing an even more effective pregnancy detection method. The benefit of this early pregnancy detection is that identifying animals that are not pregnant very shortly after breeding, allows for timely rebreeding and minimizes the amount of time the animal is open. Also disclosed are methods for making a breeding decision for an animal. These methods allow a herd manager to make breeding decisions based on the levels of PAG-55 protein fraction and optionally, progesterone levels detected in a biological sample taken from an animal suspected of being in the early stages of pregnancy.
Owner:MONSANTO TECH LLC

Alpha-fetoprotein peptides and uses thereof

Therapeutic compounds which are cell proliferation modulators, preferably inhibitors. These modulators contain amino acid structures that are arranged as a hydrophilic analog of an alpha-fetoprotein. The modulator may be a peptide itself, e.g., an octapeptide like that of SEQ ID NO: 5; a peptidomimetic; or may be in the form of a pharmaceutically acceptable scaffold, such as a polycyclic hydrocarbon to which is attached the necessary amino acid structures for biological and / or chemical activity. The modulators of the invention are distinguished in one aspect over previous compounds in that they are orally active, and therefore do not have to be injected into the patient. The compositions and methods are useful for reducing estrogen-dependent and estrogen-independent growth of cells, and treating or preventing cancer, such as breast cancer, brain cancer, head-and-neck cancer, thyroid cancer, lung cancer, colon cancer, ovarian cancer, prostate cancer, cervical cancer, and skin cancer. The treatment or prevention methods can include the use of tamoxifen therapy in combination with the peptide therapy.
Owner:ALBANY MEDICAL COLLEGE