85results about "Pregnancy proteins" patented technology

Disclosed are methods of purifying compounds that reduce or prevent an inflammatory response in a mammal, use of such compounds in treating a mammal having or being at risk of developing inflammation, as well as serum containing such purified compounds. Also disclosed are animal models that are more representative of humans in the study of inflammatory responses or as screening tools for discovering or developing new therapeutics or lead candidate compounds for inhibition of an inflammatory response.

The present invention relates to assay methods used for detecting the presence of PIF, and to PIF peptides identified using this assay. In particular, the present invention relates to flow cytomery assays for detecting PIF. It is based, at least in part, on the observation that flow cytometry using fluorescently labeled antilymphocyte and anti-platelet antibodies demonstrated an increase in rosette formation in the presence of PIF. It is further based on the observation that flow cytometry demonstrated that monoclonal antibody binding to CD2 decreased in the presence of PIF. The present invention further relates to PIF peptides which, when added to Jurkat cell cultures, have been observed to either (I) decrease binding of anti-CD2 antibody to Jurkat cells; (ii) increase expression of CD2 in Jurkat cells; or (iii) decrease Jurkat cell viability. In additional embodiments, the present invention provides for ELISA assays which detect PIF by determining the effect of a test sample on the binding of anti-CD2 antibody to a CD2 substrate.

The invention provides a method of reducing the damage done by reactive oxygen species (ROS) in an animal. The invention also provides a method of reducing the concentration of a metal in an animal. These methods comprise administering to the animal an effective amount of a metal-binding compound as further described in the application. The invention further provides a method of reducing the damage done by ROS to a cell, a tissue or an organ that has been removed from an animal. This method comprising contacting the cell, tissue or organ with a solution or medium containing an effective amount of a metal-binding compound of the invention. The invention further provides novel metal-binding compounds, pharmaceutical compositions comprising the metal-binding compounds, and kits comprising a container holding a metal-binding compound of the invention.

The present invention provides a new placenta resource-bovine placanta, and adopts the processes of cleaning cutting into block, homogenization, extraction, centrifugal precipitation separation, ultrafiltration of supernatant fluid, nano-fitlering to remove salt and freeze-drying so as to obtain the basic product containing active immuno regulatory activity polypeptide, then making said basic product undergo the processes of separation and purification by means of anion-exchange chromatography, gel exclusion chromatography and inversed phase high-performance liquid chromatography and freeze-drying so as to obtain the purified product.

Therapeutic compounds which are cell proliferation modulators, preferably inhibitors. These modulators contain amino acid structures that are arranged as a hydrophilic analog of an alpha-fetoprotein. The modulator may be a peptide itself, e.g., an octapeptide like that of SEQ ID NO: 5; a peptidomimetic; or may be in the form of a pharmaceutically acceptable scaffold, such as a polycyclic hydrocarbon to which is attached the necessary amino acid structures for biological and / or chemical activity. The modulators of the invention are distinguished in one aspect over previous compounds in that they are orally active, and therefore do not have to be injected into the patient. The compositions and methods are useful for reducing estrogen-stimulated growth of cells, and treating or preventing cancer, such as breast cancer. The treatment or prevention methods can include the use of tamoxifen therapy in combination with the peptide therapy.

The present invention relates to amniotic fluid specific polypeptide and a method for detecting rupture of the amniotic membranes. In particular the invention provides a marker for prolonged rupture of the membranes (PROM), which marker consists essentially of polypeptides of approximately 75 kDa, 20 kDa and 50 kDa as determined by 4-15% gradient SDS-PAGE under reducing conditions.

The invention relates to a noninvasive method and kit for capturing and separating fetus cells from a parent, in particular to a promoter of fetus trophoblast cell specific expression gene, a promoterof fetus nucleated red blood cell specific expression gene and recombinant I type herpes virus hominis. Gene segments related to pathogenicity are eliminated from the recombinant I type herpes virushominis, a virus genome ICP wild type promoter is replaced by the promoter of the fetus trophoblast cell specific expression gene or the nucleated red blood cell specific expression gene, and a markerfor tracing the recombinant I type herpes virus hominis is inserted into the promoter.

The present application provides constructs comprising an antibody moiety that specifically binds to a complex comprising an AFP peptide and an MHC class I protein. Also provided are methods of making and using these constructs.

The invention relates to compounds that include peptide and peptidomimetics that inhibit estrogen receptor dependent cell proliferation. The compounds of the invention are useful for treating cell proliferative disorders or physiological conditions characterized by undesirable or unwanted estrogen induced cell proliferation, including breast cancer.

Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.

Disclosed are methods for determining the pregnancy status of a cow by detecting a pregnancy-associated glycoprotein (PAG) level that comprises proteins present in an acidic protein fraction of day 55 to day 60 bovine placental tissue. These methods may involve using novel polyclonal and monoclonal antibodies that have been generated using the acidic protein fraction as an immunogen. According to the method, the cow is pregnant when the PAG level is present at an elevated level in a sample obtained from the cow. The invention provides accurate methods of detecting pregnancy at early stages and has the benefit of allowing early post partum detection of pregnancy status with few false positive results. The antibodies for detecting the PAG level will also be useful in combination with detecting elevated progesterone levels, thus providing an even more effective pregnancy detection method. The benefit of this early pregnancy detection is that identifying cows that are not pregnant very shortly after breeding allows for timely rebreeding and minimizes the amount of time the cow is open. Also disclosed are methods for making a breeding decision for a cow. These methods allow a herd manager to make breeding decisions based on the PAG level and optionally, progesterone levels, detected in a biological sample taken from a cow suspected of being in the early stages of pregnancy.

The invention relates to compounds that include peptides that inhibit estrogen receptor dependent cell proliferation. The compounds of the invention are useful for treating cell proliferative disorders or physiological conditions characterized by undesirable or unwanted estrogen induced cell proliferation, including breast cancer.

Disclosed are methods for determining the pregnancy status of an ungulate animal by detecting the level of PAG-55 protein fraction. These methods may involve the detection of PAG-55 enriched proteins in the PAG-55 protein fraction by using novel polyclonal and monoclonal antibodies that have been generated using the PAG-55 enriched protein fraction as an immulogen. The novel PAG-55 protein fraction indicates that the animal is pregnant when the acidic PAG-55 protein fraction, or antigenic components thereof, are present at an elevated level in a sample. The present invention also provides for methods of obtaining the PAG-55 enriched protein fraction. The invention provides accurate methods of detecting pregnancy at early stages and has the benefit of allowing early post partum detection of the pregnancy status with few1 false positive results. The antibodies for detecting PAG-55 proteins will also be useful in combination with detecting elevated progesterone levels in the animal, thus providing an even more effective pregnancy detection method. The benefit of this early pregnancy detection is that identifying animals that are not pregnant very shortly after breeding, allows for timely rebreeding and minimizes the amount of time the animal is open. Also disclosed are methods for making a breeding decision for an animal. These methods allow a herd manager to make breeding decisions based on the levels of PAG-55 protein fraction and optionally, progesterone levels detected in a biological sample taken from an animal suspected of being in the early stages of pregnancy.

Therapeutic compounds which are cell proliferation modulators, preferably inhibitors. These modulators contain amino acid structures that are arranged as a hydrophilic analog of an alpha-fetoprotein. The modulator may be a peptide itself, e.g., an octapeptide like that of SEQ ID NO: 5; a peptidomimetic; or may be in the form of a pharmaceutically acceptable scaffold, such as a polycyclic hydrocarbon to which is attached the necessary amino acid structures for biological and / or chemical activity. The modulators of the invention are distinguished in one aspect over previous compounds in that they are orally active, and therefore do not have to be injected into the patient. The compositions and methods are useful for reducing estrogen-dependent and estrogen-independent growth of cells, and treating or preventing cancer, such as breast cancer, brain cancer, head-and-neck cancer, thyroid cancer, lung cancer, colon cancer, ovarian cancer, prostate cancer, cervical cancer, and skin cancer. The treatment or prevention methods can include the use of tamoxifen therapy in combination with the peptide therapy.