Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

34 results about "Glucagon-like peptide-2" patented technology

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

Construction method and application of recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2

The invention discloses a construction method and application of recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2. The construction method comprises the following steps: designing a primer containing specific restriction enzyme digestion site according to gene sequence and expression vector plasmid characteristic of disclosed glucagon-like peptide-2; by using small intestinal mucosa as a material, carrying out RT-PCR (reverse transcription-polymerase chain reaction) to obtain fragment containing glucagon-like peptide-2 gene; connecting the fragment with lactobacillus expression vector plasmid Pmg36e to obtain recombinant plasmid Pmg36e-glp2; transferring the recombinant plasmid in actobacillus acidophilus through an electrotransformation method to obtain recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2; expressing under the induction of nisin; and analyzing and proving that the gene is correctly expressed through SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) and Western blot. The recombinant lactobacillus acidophilus is used for preventing and treating diarrhea, improving the intestinal health of pig and improving the growth performance.
Owner:SHENZHEN JINXINNONG FEED

Production of glucagon like peptide 2 and analogs

GLP-2 peptides and analogs thereof are produced in high yield and with desired, authentic termini by isolation from a GLP-2 peptide multimer in which at least two units of GLP-2 peptide are coupled through a linker that presents an N-terminal acid cleavage site and a C-terminal enzyme cleavage site. In a specific embodiment, [Gly2]hGLP-2 is produced from a multimeric precursor comprising 2-30 units thereof.
Owner:NPS PHARM INC

Construction method and application of recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2

The invention discloses a construction method and application of recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2. The construction method comprises the following steps: designing a primer containing specific restriction enzyme digestion site according to gene sequence and expression vector plasmid characteristic of disclosed glucagon-like peptide-2; by using small intestinal mucosa as a material, carrying out RT-PCR (reverse transcription-polymerase chain reaction) to obtain fragment containing glucagon-like peptide-2 gene; connecting the fragment with lactobacillus expression vector plasmid Pmg36e to obtain recombinant plasmid Pmg36e-glp2; transferring the recombinant plasmid in actobacillus acidophilus through an electrotransformation method to obtain recombinant lactobacillus acidophilus for expressing glucagon-like peptide-2; expressing under the induction of nisin; and analyzing and proving that the gene is correctly expressed through SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) and Western blot. The recombinant lactobacillus acidophilus is used for preventing and treating diarrhea, improving the intestinal health of pig and improving the growth performance.
Owner:SHENZHEN JINXINNONG FEED
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products