45 results about "Helix" patented technology

The invention relates to a nano groove array and a manufacturing method and application thereof, and the manufacturing method of the nano groove array comprises the following steps: taking single-stranded DNA (ssDNA) as a DNA brick, and carrying out self-assembly by adopting a complementary pairing principle of the ssDNA to obtain the nano groove array with a base and a side wall; wherein the width and the height of the nano groove array are fixed, the number of grooves is determined, and the nano groove array extends along a single direction; in the nano groove array, the width of the side wall and the width of the groove are equivalent to the diameter of two double-helix DNA (dsDNA). Compared with the prior art, the number of the grooves of the nano groove array is controllable, the width of the grooves is 4 nm, the period of the groove array is 8 nm, and the self-assembly defect can be greatly reduced.

A magnetic component is disclosed and includes a first magnetic core, a second magnetic core and a coil. The first magnetic core includes a first magnetic cover and a first guiding portion. The second magnetic core includes a second magnetic cover and a second guiding portion. The first magnetic core and the second magnetic core are butted along an axial direction to form a winding column. The first guiding portion is located on the first magnetic cover, and increases a depth embedded into the first magnetic cover. The second guiding portion is located on the second magnetic cover, and increases a depth embedded into the second magnetic cover. The coil is wound on the winding column at a helical angle α relative to the winding column, and includes a first outlet terminal and a second outlet terminal led out along the first guiding portion and the second guiding portion, respectively.

The invention discloses an integrated rectifier diode module of a three-dimensional spiral structure, and relates to the technical field of power semiconductor devices, the integrated rectifier diode module of the three-dimensional spiral structure comprises an electrical function unit and a thermal management unit which are integrated in a monolithic mode, and the electrical function unit and the thermal management unit are coaxially arranged to achieve electric-thermal collaborative optimization. The specific structure is as follows: the electrical function unit comprises a substrate layer, an N + GaN conduction layer, an N-GaN drift layer and a three-dimensional spiral super-junction structure embedded in the N-GaN drift layer, the substrate layer, the N + GaN conduction layer, the N-GaN drift layer and the three-dimensional spiral super-junction structure are sequentially stacked from bottom to top, the three-dimensional spiral super-junction structure is formed by alternately and spirally arranging P-NiO regions and N-GaN regions, and charge balance is achieved; the electrical function unit further comprises an anode electrode and a cathode electrode, the anode electrode is arranged at the top of the three-dimensional spiral super-junction structure, and the cathode electrode is arranged on the surface of the N + GaN conduction layer; according to the invention, the power density is improved, the high-power application requirement is met, the device is suitable for the high-power-density field, the environmental adaptability is high, and the stable performance can be kept at different working temperatures.

Device (1) for generating electromagnetic radiation, comprising a wire helix (3) consisting of a wire, which is arranged in a tube (5) with a wall (7) transparent to electromagnetic radiation of a predetermined wavelength, wherein the tube (5) is closed at the ends (5a, 5b) and forms a closed space (5c) in which the wire helix (3) is arranged and which is filled with a noble gas or a noble gas mixture, wherein the wire helix (3) is formed at least over a predetermined section (11) as two mutually rotating, interlocking helices with a common central axis (12).

Apparatus and associated methods relate to measuring position and displacement of a 2D surface magnet array of at least three adjacent magnetic north and south tracks with an acute angle versus its motion displacement relative to a magnetic field sensor (e.g., magnetic sensing probe). In an illustrative example, the geometry of the 2D surface magnet array may be planar with adjacent and alternating north and south pole regions. In some embodiments, the 2D surface magnet array geometry may take the form of (1) an axial cylindrical helical multipole magnet array having individually magnetized layers that are oriented in helical shape, or (2) a radial disk spiral multipole magnet array with at least three adjacent north and south tracks oriented as a spiral shape.

Device for producing a double-walled tube from a sheet (2) comprising: at least one first pair of profile rolls (4a, 4b, 5a, 5b) for producing a Z-profile with a middle leg having a length and two outer legs in the sheet (2), wherein a pair of profile rolls (4a, 4b, 5a, 5b) has an upper profile roll (4a, 5a) and an opposing lower profile roll (4b, 5b), and at least one bending upper roll (7a) and one bending lower roll (8b) for producing a circular bend in the sheet (2), wherein the bending upper roll (7a) and the bending lower roll (8b) are arranged to simultaneously produce a helix in the sheet (2), such that adjacent turns of the helix partially overlap, a device for connecting a first passage of the helix with an adjacent second passage of the helix wherein the middle leg of the Z-profile has a length such that the overlapping outer legs of the Z-profile are spaced apart from each other in the direction of the diameter of the helix when they are coiled into a helix and rounded.

The present disclosure provides a method of extending the path of a biological sample flow in a lateral flow assay on a test strip including a membrane. The method includes arranging the membrane in a helical shape in a test strip. The helical shape extends the flow path increasing interaction time between the biological sample and binding reagents on the membrane as the sample flows through multiple turns of the helix. Further, a lateral flow assay on the test strip including a membrane disposed on a surface of the test strip in a helical shape is provided. The helical shape extends a path of a biological sample flow through the membrane.

An apparatus is proposed for separation of dry granular mixture into fractions with different content of particles of high density, where the spatial inhomogeneity of the concentration of dense particles in the volume of the mixture is created by rotating the dry granular mixture inside the channel curved along the spiral.

This invention discloses a method, system, and storage medium for calculating the self-torque of a bitter coil, relating to the field of water-cooled magnet technology. The method includes obtaining the basic parameters of each coil in a water-cooled magnet; dividing the conductors in the upper or lower half of the coil into several annular grids; determining the coordinates of the grid center points based on the basic parameters; calculating the total radial magnetic field component at each grid center point; using the integral of the current density distribution of each grid over the single-turn cross-sectional area of ​​the coil, which equals the target current flowing through the coil, to solve for the current density distribution at each grid location; calculating the helix angle sine of the current helix path within the grid based on the helix path plane of the grid; calculating the axial current density component of each grid based on the current density distribution at each grid location and the corresponding helix angle sine; and calculating the electromagnetic torque of the coil when the target current flows through it based on the total radial magnetic field component and the axial current density component of each grid.

The present application relates to the technical field of tool edge type design, and specifically discloses a tool optimal edge type design method for chatter suppression under specific working conditions, comprising the following steps: S1, setting the helix angle and initial pitch of the tool as the optimization parameters; S2, calculating the critical stable axial depth of cut under specific working conditions through a critical depth of cut calculation function based on the optimization parameters; and S3, finding the local optimal edge type through a particle swarm algorithm with the critical axial depth of cut as the adaptive function. The tool optimal edge type design method for chatter suppression under specific working conditions has the advantages that it does not need to draw a complete SLD under global rotational speed, greatly improves the calculation efficiency, and can comprehensively consider the influence of the helix angle and pitch on chatter suppression, optimize the tool edge type in a wider edge type space, and accurately match the chatter suppression requirements of specific working conditions.

A coil component (100), comprising: a substrate (101) and a planar spiral coil pattern (CP1, CP2) arranged on a surface of the substrate (101), wherein the coil pattern (CP1, CP2) has a higher roundness in its inner shape (ID) than in its outer shape (OD), wherein the outer shape (OD) of the coil pattern (CP1, CP2) has a first and a second section (311, 312) extending in a first direction, a third section (313) extending in a second direction perpendicular to the first direction, a fourth section (314) arranged between the first and the second section (311, 312) extending straight and obliquely to the first direction, and a fifth section (315) arranged between the second and the third section (312, 313) being curved such that its direction of extension changes from the first direction to the second direction, where the first, fourth, second, fifth and third sections (311, 314, 312, 315, 313) follow one another in this order, wherein the inner shape (ID) of the coil pattern (CP1, CP2) has a sixth section (316) corresponding to the first section (311) and extending in the first direction, a seventh section (317) corresponding to the third section (313) and extending in the second direction (312), an eighth section (318) corresponding to the fourth section (314) and extending straight and obliquely to the first direction, and a ninth section (319) corresponding to the fifth section (315) and curved such that its direction of extension changes from the first direction to the second direction, where the sixth, eighth, ninth and seventh sections (316, 318, 319, 317) follow one another in this order and where the ninth section (319) is not connected to the eighth section (318) by a section extending in the first direction.

An automated installation system, constructed to install tangless helically coiled inserts, includes an installation tool, a track, and an insert separator device. The tool includes a nozzle body defining a through-bore extending along an insertion axis, and a mandrel adapted to reciprocate and rotate within the bore. The track defines a channel extending along a first centerline for the travel of inserts disposed in the channel and to the installation tool. The device is mounted to the track and includes a shuttle adapted to intersect and move in the channel. The shuttle defines a through-bore having an axis aligned to the first centerline when in a first position for acceptance of an insert from the channel, and is aligned to a second centerline for expulsion of the insert from the track and into the installation tool. The second centerline is offset from the first centerline, and intersects the insertion axis.

1. The name of the design product: the gradual spiral angle wave milling cutter. 2. The use of the design product: for milling metal materials. 3. The design points of the design product: in shape. 4. The picture or photo that best shows the design points: perspective view 1.

The invention discloses a self-expansion type single-channel spiral flow deflector which comprises a flow guide part which is of a continuous spiral sheet structure and can be compressed when pressure is applied to the outer side of the flow guide part; the outer side of the flow guide part is sleeved with a sleeving part, and the sleeving part can limit the compressed flow guide part; through mechanical constraint shaping, elastic recovery expansion of the flow deflectors within 15 seconds is achieved, and interference fit with the casing pipe under the attaching pressure larger than or equal to 3 MPa is formed; by means of the optimized design of shape memory alloy pre-compression, a mechanical constraint release activation mechanism, an interference fit fixing mode with a sleeve, a reserved center cavity with the diameter larger than or equal to 0.5 D, a compatible ignition device with the diameter smaller than or equal to 300 mm, the spiral angle ranging from 25 degrees to 40 degrees and the screw pitch ranging from 0.6 D to 1.0 D, airflow is guided to form a 5-8 m / s rotating flow field, the gas-solid contact time is prolonged by 25%-35%, and the carbon conversion rate is increased by 10%-15%; the yield of synthesis gas (H + CO) is increased by 8-12%; and ash accumulation is inhibited by centrifugal force.

The invention discloses a theoretical model for spiral self-feeding shape correction of a pipe, which comprises the following steps of: establishing a theoretical formula of total kinetic energy T of the pipe on the basis of a thin-wall hypothesis under the conditions that a rotating shaft of the pipe is assumed to coincide with a bent plane and axial rolling of the pipe is ignored; establishing a simplified theoretical formula of potential energy V of the pipe on the basis of a reciprocating bending unified curvature theorem and a bidirectional effect under the condition of neglecting plastic dissipation of the pipe; modeling is conducted on the movement track of the pipe on the basis of the Lagrange equation so as to obtain a movement track equation set, and the movement track equation set comprises a coupling relational expression among the circumferential bending angle of the pipe, the spiral azimuth angle of the pipe and the axial self-feeding displacement s; wherein the Lagrange equation is as follows: Qq is the generalized force applied to the pipe, L is the Lagrange quantity, and q is the generalized coordinate system and is a first derivative of q.

This invention, based on deep learning and molecular dynamics simulations, yielded a novel antimicrobial peptide, yuce 4, designed using artificial intelligence, exhibiting highly efficient and broad-spectrum antimicrobial activity. The existence of the α-helix in yuce 4 was confirmed by nuclear magnetic resonance (NMR), circular dichroism (CD) chromatography, and Alphafold 2 three-dimensional structure prediction. Furthermore, mutants of yuce 4 were designed, showing a 4-8 fold increase in activity against Stenotrophomonas maltophilia WH006 and Pseudomonas aeruginosa PAO1, with several analogs achieving a MIC of 8 μg / mL. This invention also demonstrates the potential of deep learning and molecular dynamics simulations in accelerating the discovery of antimicrobial peptides and shows promise as an important tool for developing novel antimicrobial peptides.

1. The name of the design product: spiral (double helix). 2. The use of the design product: used for spiral sampling head sampling. 3. The design points of the design product: in shape. 4. The picture or photo that best indicates the design points: perspective view 1.

Component characterized in that it has at least one guide curve which is generated by axial continuation of a single closed, egg-shaped two-dimensional initial contour, wherein exactly two counter-rotating spiral strands are created by iterative multiplication and axial displacement of this initial contour, which repeatedly intersect along the longitudinal axis.

Antigen binding constructs comprising alpha-helix masking structures and methods of making such masking antigen binding constructs are provided. In one aspect, the methods relate to a computer-aided method for designing an alpha-spiral masking structure.

The invention discloses a singular point topology alignment-based model processing method and device and a storage medium, and relates to the technical field of model processing, and the singular point topology alignment-based model processing method comprises the steps of constructing a first regular family structure corresponding to a half structure of a model grid, the first normal family structure comprises at least one first normal family, and the first normal family comprises at least one dual string; based on the first normal family of which the width is greater than a preset width threshold value, searching to obtain a spiral dual string in the model grid; searching and eliminating a spiral path of the spiral dual chord so as to eliminate spirals in the model grid; constructing a second regular family structure of the model grid after the helix is eliminated; and processing the second regular family structure based on string drawing and / or string filling so as to align non-spiral dual strings of the model grid and obtain the model grid after topology alignment. According to the method, singular point fragments of the full-quadrilateral grid are reduced, and the fragment size is increased, so that the structured degree and the grid quality of the grid are improved.

The invention provides an auxiliary measuring device and method for the helix angle of a U-shaped bent pipe. The device comprises a supporting swing angle mechanism, a rotation angle measuring mechanism and a threaded jack. The supporting swing angle mechanism is provided with a supporting platform, a universal bubble level is arranged at one end of the supporting platform, a semi-cylindrical plate support is hinged to the other end of the supporting platform, the extending end of the semi-cylindrical plate support abuts against the pipe supporting plate, and the inclination angle of the semi-cylindrical plate support is adjusted through a fine adjustment screw. The corner measuring mechanism is provided with a flat plate, the lower surface of the flat plate is tightly hooped on the upper surface of the terminal straight section of the U-shaped bent pipe through a double-hook elastic belt, and a strip-shaped bubble level is arranged at one end of the upper surface of the flat plate; the inclination angle of the rotating plate is adjusted through the plate supporting screw rod, and another strip-shaped bubble level is arranged on the rotating plate; the threaded jack is used for lifting the U-shaped bent pipe; the two sets of supporting swing angle mechanisms are arranged at the positions, close to the two straight sections, of the U-shaped bent pipe, and the threaded jacks abut against the bottoms of the two ends of the lowest straight section of the U-shaped bent pipe to support the straight sections of the U-shaped bent pipe.

The present invention provides a CD16a binding polypeptide comprising at least one motif binding to CD16a, wherein the CD16a binding polypeptide comprises the following structure: [N-terminal portion]-[helix 1]-[separated portion]-[helix 2]-[C-terminal portion], wherein the CD16a binding motif is a partial [helix 1]-[separated portion]-[helix 2]; wherein the CD16a binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO:1). The present invention also provides a CD16a-binding polypeptide comprising at least one motif binding to CD16a, wherein the CD16a-binding polypeptide comprises the following structure: [N-terminal portion]-[helix 1]-[separated portion]-[helix 2]-[C-terminal portion], wherein the CD16a-binding motif is a partial [helix 1]-[separated portion]-[helix 2]; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO:2). The present invention also provides a CD16a binding polypeptide comprising the following structure: [BCMA binding polypeptide]-[linker 1]-[BCMA binding polypeptide]-[linker 2]-[CD16a binding polypeptide], wherein: each BCMA binding polypeptide comprises the following sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO:4); the CD16a binding polypeptide comprises the following sequence: VDNKFNKEQQIAQYEIRRLPNLN HHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO:2) or comprises the following sequence: VDNKFNKEQQIAQ YEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO:2). NO:3); and each of connector 1 and connector 2 has the sequence (GGGSG)n, where n is 1, 2 or 3. The present invention also provides CD16a binding-drug conjugates and pharmaceutical compositions comprising CD16a binding peptides, and the use of CD16a binding peptides, CD16a binding-drug conjugates or pharmaceutical compositions in medicine, particularly in the treatment of cancers such as multiple myeloma.

The invention discloses a design method and system for high transmission stability of a line contact spiral bevel gear pair, and the method comprises the steps: determining the reference diameter d1 of the large end of a small gear tooth, the number z1 of small gear teeth, and the number z2 of large gear teeth according to a given gear pair transmission ratio i, the torque T or power P needing to be transmitted, and the modulus m of the large end of the gear teeth; establishing a function relationship between a midpoint helix angle beta m and a longitudinal contact ratio epsilon beta under the condition of keeping the reference diameter d1 of the large end of the small wheel tooth unchanged; based on a calculation formula of the total contact ratio epsilon r of the bevel gear, obtaining a function relationship between the midpoint helix angle beta m and the total contact ratio epsilon r; according to the obtained function relation, the total contact ratio epsilon r of the gear pair is set to be a certain integer value, so that the corresponding midpoint helix angle beta m is determined, and geometric parameter design of the gear pair is preliminarily completed. The method has the advantages that the influence of the helical angle and the contact ratio on the dynamic meshing characteristic is considered in the tooth surface design stage, the actual gear pair transmission error is reduced, and design and manufacturing of the high-performance line contact spiral bevel gear pair are achieved.

The present disclosure provides a cutting tool that comprises: an end cutting edge that is formed so as to extend radially from the central axis side; a peripheral edge that forms a pair of cutting edges with the end cutting edge; and a chip discharge groove provided around the central axis. The chip discharge groove is formed by two or more grooves that include at least a major groove and a minor groove and have different helix angles from each other. The major groove that forms the peripheral edge on an edge between a peripheral side surface of the cutting tool and such major groove has a helix angle α that is the smallest helix angle, and the minor groove that is in contact with the major groove and arranged with its phase shifted forward with respect to the major groove in a tool rotating direction has a helix angle β that is greater than the helix angle α of the major groove.