14 results about "Adrenomedullin" patented technology

Subject of the invention are DPP3 binders for use in therapy or prevention of endothelial dysfunction in a patient wherein the level of Pro-Adrenomedullin or a fragment thereof in a sample of bodily fluid obtained from said patient is above a threshold, as well as methods of therapy guidance or therapy stratification or therapy monitoring of a treatment of a patient with a DPP3 binder, the methods comprising: providing a sample of bodily fluid of said patient; determining the level of Pro-Adrenomedullin or a fragment thereof in said sample; and comparing said level of Pro-Adrenomedullin or a fragment thereof to a threshold; wherein the level of Pro-Adrenomedullin or a fragment thereof in said sample being above said threshold is indicative that said patient requires treatment with a DPP3 binder, or wherein if said level of Pro-Adrenomedullin or a fragment thereof in said sample is above said threshold, said patient is treated with a DPP3 binder.

The present application provides a method of administration that maximizes the therapeutic effect of adrenomedullin, and a drug containing adrenomedullin provided by the method of administration. The above problem is solved by providing a drug for treating a disease, which contains adrenomedullin or a derivative thereof having adrenomedullin activity, etc. as an effective ingredient, characterized in that the disease is a disease for which a therapeutic effect is expected to be obtained by administration of adrenomedullin or a derivative thereof having adrenomedullin activity, or a pharmaceutically acceptable salt thereof, or a pharmaceutically acceptable solvate thereof, and the effective ingredient is administered intermittently.

The present invention provides an anti-adrenomedullin (ADM) antibody or an anti-adrenomedullin antibody fragment or an anti-ADM non-Ig scaffold for use in the treatment of a chronic or acute disease or acute condition in a patient to prevent or reduce organ dysfunction or organ failure. In a preferred embodiment, the invention provides an anti-ADM antibody or an anti-adrenomedullin antibody fragment or an anti-ADM non-Ig scaffold for use in the treatment of a chronic or acute disease or acute condition in a patient to prevent or reduce renal dysfunction or renal failure or hepatic dysfunction or hepatic failure.

Adrenomedullin (ADM) is shown to be protective against damage to neurons as a result of hypoxic brain injuries, radiation brain injuries, and to prevent neurodevelopmental injury in encephalopathy of prematurity; 22q11.2 deletion syndrome, e.g. DiGeorge Syndrome; and other neurologic diseases associated with mitochondrial dysfunction. Modified ADM peptides are provided, which are stabilized relative to the native peptide. In an embodiment, a therapeutic composition is provided, comprising an ADM analog of the disclosure, and a pharmaceutically acceptable excipient. In an embodiment, a method is provided for treating or preventing neurologic damage in an individual, the method comprising administering an effective dose of ADM.

The disclosure provides a compound or a salt thereof, or a solvate thereof, wherein the compound is a peptide selected from the group consisting of: (a) a peptide consisting of an amino acid sequence of SEQ ID NO: 3 wherein one to three amino acid residues are substituted or deleted; (b) a peptide having a disulfide bond formed by cysteine residues at positions 4 and 9 of (a); (c) a peptide wherein the disulfide bond of (b) is substituted with an ethylene group; (d) a peptide wherein one to three amino acid residues of any of (a) to (c) are deleted or added; (e) a peptide wherein any of (a) to (d) is amidated at the C-terminus thereof; and (f) a peptide wherein any of (a) to (d) has a glycine residue added to the C-terminus thereof, and the use thereof.

One embodiment of the present invention is a therapeutic agent for hereditary cerebral small vessel disease that contains adrenomedullin or the like as an active ingredient.

The present invention relates to an anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment that binds to adrenomedullin, for use in congestion therapy in a patient with congestive hypertension; heart failure, in particular acute heart failure; wherein said anti-ADM antibody or anti-ADM fragment binds to the N-terminal portion (aa 1 to 21) of adrenomedullin YRWSMNNFWGLRSFGCRFGTC (SEA ID NO. 22), and wherein said patient is resistant to diuretics or does not respond to diuretic therapy.

Anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for the treatment of a critically ill patients suffering from an acute disease or condition resulting in the accelerated the conversion of ADM-Gly to ADM-NH2 of circulating ADM-Gly in the patient. The patient has a ratio of pro-Adrenomedullin or a fragment thereof to ADM-NH2 above a predetermined threshold in a sample of bodily fluid. The pro-Adrenomedullin or fragment thereof is PAMP, MR-proADM, ADM-Gly or CT-proADM and the anti-ADM antibody or anti-ADM fragment or anti-ADM non-Ig scaffold binds to the N-terminal and / or mid-regional part (amino acid 1-42) of ADM-Gly and / or ADM-NH2: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA.

The present invention relates to anti-RAMP2 and anti-RAMP3 antibodies that inhibit the neogenesis promoting effect of adrenomedullin. The antibodies are useful in the treatment of cancer.

The utility model discloses a multi-index quantitative detection kit for heart failure. The multi-index quantitative detection kit comprises a detection card and a diluent box body, the detection card comprises a detection shell and a detection strip, the detection strip comprises a bottom plate as well as a sample pad, a combination pad, a detection pad and a sample absorption pad which are sequentially overlapped on the bottom plate, the multiple indexes comprise three indexes of adrenomedullin, peptin and angiotensin II, and the combination pad comprises a specific detection antibody which is marked by a fluorescent substance and aims at the indexes; a detection line and a quality control line are arranged on the detection pad, the detection line is coated with a specific capture antibody for capturing the index, and the quality control line is coated with a hapten or an antibody capable of being combined with the specific detection antibody; and a diluent is contained in the diluent box body. The combined detection of multiple indexes of heart failure is realized, the three indexes can be quantitatively detected within 15 minutes, the result is accurate, and the combined detection kit is suitable for hospital outpatient and emergency treatment and primary medical institutions.

The invention relates to an antibody molecule which binds RAMP3 and inhibits adrenomedullin activity, wherein the antibody molecule comprises a VH and VL chain, wherein (i) said VH chain has the amino acid sequence shown as SEQ ID NO: 65 and said VL chain has the amino acid sequence shown as SEQ ID NO: 73 [Variant 5]; (ii) said VH chain has the amino acid sequence shown as SEQ ID NO: 65 and said VL chain has the amino acid sequence shown as SEQ ID NO: 71 [Variant 3]; (iii) said VH chain has the amino acid sequence shown as SEQ ID NO: 65 and said VL chain has the amino acid sequence shown as SEQ ID NO: 74 [Variant 6]; (iv) said VH chain has the amino acid sequence shown as SEQ ID NO: 66 and said VL chain has the amino acid sequence shown as SEQ ID NO: 71 [Variant 8]; (v) said VH chain has the amino acid sequence shown as SEQ ID NO: 66 and said VL chain has the amino acid sequence shown as SEQ ID NO: 73 [Variant 10]; (vi) said VH chain has the amino acid sequence shown as SEQ ID NO: 67 and said VL chain has the amino acid sequence shown as SEQ ID NO: 71 [Variant 13]; (vii) said VH chain has the amino acid sequence shown as SEQ ID NO: 67 and said VL chain has the amino acid sequence shown as SEQ ID NO: 73 [Variant 15]; (viii) said VH chain has the amino acid sequence shown as SEQ ID NO: 68 and said VL chain has the amino acid sequence shown as SEQ ID NO: 74 [Variant 21]; or (iix) said VH chain has the amino acid sequence shown as SEQ ID NO: 69 and said VL chain has the amino acid sequence shown as SEQ ID NO: 74 [Variant 26]; and related treatments and compositions.

The present invention relates to a method for treatment management and / or prediction of disease progression, severity and / or outcome in a patient suffering from a respiratory viral infection. The method comprises the steps of: providing a first sample isolated from the patient and a second sample isolated from the patient at a point in time following isolation of the first sample from the patient, wherein the first and second samples are isolated within 96 hours (4 days) after consulting a medical staff; determining the level of one or more endothelial biomarkers in said first and said second sample wherein said one or more endothelial biomarkers are soluble Fms-like tyrosine kinase-1 (sFlt-1) or a fragment thereof, C-terminal proendothelin-1 (CT-proET-1) or a fragment thereof, and / or an adrenomedullin precursor (proADM) or a fragment thereof, and wherein said one or more endothelial biomarkers are soluble Fms-like tyrosine kinase-1 (sFlt-1) or a fragment thereof, C-terminal proendothelin-1 (CT-proET-1) or a fragment thereof, and / or an adrenomedullin precursor (proADM) or a fragment thereof; and wherein a lower or equal level of the one or more endothelial biomarkers in the second sample compared to the first sample indicates that the patient has no risk of an adverse clinical outcome within at least 28 days. The invention also relates to a kit for carrying out the method of the invention.

Subject matter of the present invention is adrenomedullin-Gly (SEQ ID NO: 6) or fragments or modifications thereof for use in the treatment of a disease or medical condition in a patient in need thereof, wherein the fragments have a length of at least 6 amino acids counted from the N-terminus of ADM-Gly and wherein said fragments optionally have a C-terminal amide-group, wherein the level of Dipeptidylpetidase 3 (DPP3) in a sample of a bodily fluid of said patient is above a threshold. Further subject matter of the present invention is a DPP3 binder for use in the treatment of a disease or medical condition in a patient in need thereof that is to be treated or has received treatment with an anti- ADM binder, in particular an anti-ADM antibody or anti-ADM antibody fragment or anti-ADM non-Ig scaffold, wherein said patient has a level of DPP3 in a sample of bodily fluid above a threshold. A further subject matter of the present invention is an anti-ADM binder, in particular an anti-ADM antibody for use in the treatment of a disease or medical condition in a patient in need thereof that is to be treated or has received treatment with a DPP3 binder, wherein said patient has a level of DPP3 in a sample of bodily fluid above a threshold.

Subject matter of the present invention is an anti-Adrenomedullin (ADM) antibody or an anti-Adrenomedullin antibody fragment or an anti-ADM non-Ig scaffold for use in intervention and therapy of congestion in a patient in need thereof.