151 results about "Zinc finger" patented technology

The invention relates to the technical field of gene engineering, in particular to a soybean disease-resistant RING-H2 type zinc finger protein gene GmRHF1 and application thereof.According to the technology, the GmRHF1 genes are cloned in soybean varieties Xu bean 14 and Shangshan black beans respectively, and then the expression quantity difference of the genes in different tissues and the expression quantity change trend of the genes under SMV treatment are analyzed through fluorescent quantitative PCR; meanwhile, the anti-SMV function of the GmRHF1 is verified in effective plant silencing and transgenic overexpression by adopting a virus-induced gene transient silencing technology and a soybean stable genetic transformation experiment. Finally, the interaction protein of the GmRHF1 is screened and verified through yeast cDNA library screening, yeast point verification and luciferase complementary test screening, and the biological significance of interaction of the GmRHF1 and the GmClpP6 on soybean SMV resistance is defined. In conclusion, the result of the invention can provide an effective gene resource for cultivating a new variety (line) of soybean with high SMV resistance.

The present disclosure relates generally to compounds that bind to and act as degraders of IKAROS family zinc finger (IKZF) proteins, such as IKZF2 (Helios) and / or IKZF4 (Eos). The disclosure further relates to the use of the compounds for the preparation of a medicament for the treatment of diseases and / or conditions through the binding and degradation of IKZF proteins, such as IKZF2 and / or IKZF4, including cancer.

Disclosed are polypeptides comprising two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and wherein the second polypeptide domain comprises a zinc finger protein 865 (ZNF865) or fragment thereof. Disclosed are polynucleotides capable of encoding a polypeptide comprising two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and wherein the second polypeptide domain comprises ZNF865 or fragment thereof. Disclosed are vectors comprising one or more of the polynucleotides. Disclosed are methods of using the disclosed polypeptides, polynucleotides and vectors.

The present disclosure relates to dihydropyrimidine-2, 4 (1H, 3H) -dione-containing polycyclic compounds, or pharmaceutically acceptable salts thereof, and compositions thereof which are effective to reduce or modulate widely interspaced zinc finger motifs (WIZ) protein expression levels and / or induce fetal hemoglobin (HbF) expression, and also relates to methods of their preparation and their use in treatment of subjects in need.

This invention is related to molecules and methods of use of said molecules or compounds comprising said molecules. A molecule may be a pomalidomide or a thalidomide analogue. A method of inducing degradation of a target protein comprising one or more zinc finger polypeptides in a cell may comprise exposing a cell transfected with the target protein with a molecule as described herein, a pharmaceutically acceptable salt thereof, or any combination thereof. A method of inducing degradation of a target protein comprising one or more FK506 binding protein (FKBP) domains or degradation of a target amine in a cell may comprise exposing a cell transfected with the target protein or comprising the target amine with a composition comprising a molecule as described herein, a pharmaceutically acceptable salt thereof, or any combination of compositions comprising molecules as described herein and pharmaceutically acceptable salts thereof. A method may improve on-target effects and reduce off-target effects.

The present disclosure generally relates to compounds that bind to and act as degraders of IKAROS family zinc finger (IKZF) proteins, such as IKZF2 (Helios) and / or IKZF4 (Eos). The present disclosure further relates to the use of the compounds for the preparation of medicaments for the treatment of diseases and / or conditions through the binding and degradation of IKZF proteins, such as IKZF2 and / or IKZF4, including cancer. The present disclosure provides compounds useful as degraders of IKAROS family zinc finger (IKZF) protein 2 (IKZF2; Helios). The present disclosure further relates to the use of the compounds for the treatment and / or prevention of diseases and / or conditions through the binding and degradation of IKZF2 proteins by the compounds.

The invention discloses application of a rice zinc finger protein OsRFI2 and a coding gene thereof in disease-resistant breeding, and belongs to the field of gene engineering. The rice zinc finger protein OsRFI2 is identified, the amino acid sequence of the rice zinc finger protein OsRFI2 is as shown in SEQ ID NO.2, and the nucleotide sequence of the coding gene OsRFI2 is as shown in SEQ ID NO.1. According to the invention, Zhonghua-11 rice is taken as a background, a knockout plant and an overexpression plant of the OsRFI2 gene are constructed, inoculation experiment results show that the scab length of the overexpression plant of the OsRFI2 gene is significantly smaller than that of the background plant, the overexpression of the OsRFI2 gene significantly improves the resistance of the rice plant to rice blast, and the rice zinc finger protein OsRFI2 positively regulates the disease resistance of the plant. The invention provides a new breeding strategy and a new breeding material for rice disease-resistant breeding, and has great economic benefits and wide application prospects for rice production.

The invention discloses a Pennisetum americanum transcription factor gene PgC3H11 for improving plant cold resistance and application thereof, and belongs to the technical field of gene engineering. The CDS sequence of the transcription factor gene PgC3H11 of the pennisetum americana is as shown in SEQ ID NO. 25. The zinc finger protein gene PgC3H11 is identified in pennisetum americana, the expression of the gene is induced by low-temperature stress, and the cold resistance of a transgenic plant can be enhanced by improving the expression level of the CBFs gene. The gene has important production value for improving the cold resistance of plants, creating excellent parent elements with high cold resistance and cultivating cold-resistant varieties.

Described herein are engineered nuclease enzymes comprising mutations in a cleavage domain (e.g., FokI or a homolog thereof) and / or a DNA binding domain (zinc finger protein, TALE, single guide RNA) such that target specificity is increased.

The invention provides a retrotransposase, which comprises a target DNA binding structural domain containing a zinc finger binding motif, a reverse transcriptase structural domain and an endonuclease structural domain, and can be used for reversely transcribing RNA (Ribonucleic Acid) into DNA. The amino acid sequence of the retrotransposase is shown as any one of SEQ ID No.1 to 6 or SEQ ID No.32 to 43 or SEQ ID No.68 to 71 or has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% and 99% identity with the amino acid sequence of any one of SEQ ID No.1 to 6 or SEQ ID No.32 to 43 or SEQ ID No.68 to 71. The invention also relates to a system for modifying DNA. The system comprises the retrotransposase provided by the invention or a nucleic acid encoding the retrotransposase provided by the invention; and a donor RNA or a nucleic acid encoding the donor RNA, the donor RNA comprising: a sequence that binds to the retrotransposase and a heterologous sequence.

The use of a wild soybean zinc finger protein GsZFP4 or an encoding material thereof. The nucleotide sequence of a gene GsZFP4 which encodes the wild soybean zinc finger protein GsZFP4 is shown as SEQ ID NO. 1. A constructed plant over-expression vector pBA002-GsZFP4 is transformed into soybeans. After treatment with the SMV strain SC7 for 21 days, it is found that soybeans that over-express GsZFP4 have obviously relieved disease symptoms and remarkably reduced SMV content, and show resistance against SMVs. In general, GsZFP4 may positively regulate the resistance of soybeans against SMVs.

The present disclosure relates to dihydropyrimidine-2,4(1H,3H)-dione-containing polycyclic compounds, or pharmaceutically acceptable salts thereof, and compositions thereof which are effective to reduce or modulate widely interspaced zinc finger motifs (WIZ) protein expression levels and / or induce fetal hemoglobin (HbF) expression, and also relates to methods of their preparation and their use in treatment of subjects in need.

The invention discloses a biomarker for rapidly evaluating the radiation exposure dose of a human body and application of the biomarker. The biomarker is zinc finger matrix protein type protein 3 (ZMAT3). Compared with an existing biological dose estimation method, the method has the advantages of being simple, convenient, rapid, accurate and high in throughput, and is particularly suitable for radiation biological dose estimation of large population samples under nuclear and radiation accidents.

The invention discloses a brassica plant drought resistance negative regulation factor BnaA9.TZF5 and application of the brassica plant drought resistance negative regulation factor BnaA9.TZF5. The BnaA9.TZF5 is a transcription factor gene for coding CCCH type zinc finger protein in brassica napus, and a knockout plant obtained by performing targeted editing on the BnaA9.TZF5 through CRISPR / Cas9 shows that the drought resistance is remarkably enhanced along with phenotypic changes such as increase of leaf epidermis wax deposition and reduction of water loss rate; and an overexpression plant of the gene shows that the wax is reduced, the water loss is accelerated and the drought resistance is weakened, so that the BnaA9.TZF5 is a negative regulation factor for the drought resistance of the brassica plant. The BnaA9.TZF5 gene expression is knocked out to improve the drought resistance of brassica plants, the BnaA9.TZF5 gene can be used for molecular breeding of crops such as brassica napus, Chinese cabbage, cabbage and mustard, and a novel drought-resistant improved target gene is provided.

Provided herein, inter alia, are compositions for treating Human T-cell lymphotropic virus type 1 (HTLV-1) associated diseases. The compositions include a protein having a zinc finger domain capable of binding a sequence within an HTLV-1 long terminal repeat (LTR). Further provided are methods of treating HTLV-1 associated diseases in a subject in need thereof. The methods include administering to the subject the protein including the zinc finger domain, or a nucleic acid encoding the protein.

Fusion proteins comprising a DNA binding domain, e.g., a TAL effector repeat array or zinc finger, and a catalytic domain comprising a sequence that catalyzes hydroxylation of methylated cytosines in DNA, and methods of use thereof.

Methods and compositions for treating a corneal wound and / or increasing a population of limbal epithelial stem cells (LESCs) and / or early transit amplifying cells (eTAs) in the limbal epithelium of a subject in need thereof. The methods can include administering a therapeutic agent to the subject that: i) results in an increase in concentration of IFITM1 (Interferon Induced transmembrane Protein 1) in the limbal epithelium of the subject; and / or ii) results in a decrease in concentration of OVOL1 (Ovo Like Zinc Finger 1) in the limbal epithelium of the subject. Also provided are adeno-associated viruses (AAVs). The AAVs comprise a heterologous nucleic acid sequence encoding IFITM1 or a variant thereof, operably linked to a regulatory sequence.

Compositions and methods are provided for introducing transgenic target sites for Site Specific Integration (SSI) and / or polynucleotides of interest into at least one double-strand break target site of a double-strand-break inducing agent in a genomic window of a plant genome. Also provided are methods and compositions for producing a complex trait locus in a genomic window of a plant comprising at least one transgenic target site for site specific integration integrated in at least double-strand-break target site. The double-strand-break target site can be, but is not limited to, a target site for a zinc finger endonuclease, an engineered endonuclease, a meganuclease, a TALENs and / or a Cas endonuclease. The genomic window of said plant can comprise at least one genomic locus of interest such as a trait cassette, a transgene, a mutated gene, a native gene, an edited gene or a site-specific integration (SSI) target site.

The invention belongs to the technical field of plant heredity and genetic engineering, and particularly relates to a cold-resistant and bolting-resistant related gene BraTZF3 of Chinese cabbage and application of the cold-resistant and bolting-resistant related gene BraTZF3. A stress-related transcription factor BraA01g008400.3 C is screened by combining a yeast stress library screening technology with transcriptome analysis, the stress-related transcription factor BraA01g008400.3 C belongs to a co-tandem C3H type zinc finger protein and comprises a C-x8-C-x5-C-x3-H zinc finger (ZNF) structural domain, and tests prove that the BraTZF3 is positively correlated to low-temperature stress response and cold resistance, and the BraA01g008400.3 C can be used for preparing the stress-related transcription factor BraA01g008400.3 C. According to the present invention, the BraTZF3 is subjected to heterologous overexpression to positively regulate the cold resistance and the bolting resistance of arabidopsis thaliana, such that the gene provides the positive regulation effect on the cold resistance and the bolting resistance of the plant, especially the Chinese cabbage, and the new tool and the new method are provided for improving the cold resistance and the bolting resistance of the crop by using the gene engineering means so as to provide the good practical application value;

The invention provides a retrotransposase, which comprises a target DNA binding structural domain containing a zinc finger binding motif, a reverse transcriptase structural domain and an endonuclease structural domain, and can be used for reversely transcribing RNA (Ribonucleic Acid) into DNA. The invention also relates to a system for modifying DNA. The system comprises the retrotransposase provided by the invention or a nucleic acid encoding the retrotransposase provided by the invention; and a donor RNA or a nucleic acid encoding the donor RNA, the donor RNA comprising: a sequence that binds to the retrotransposase and a heterologous sequence.

Disclosed are polypeptides comprising two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and wherein the second polypeptide domain comprises a zinc finger protein 865 (ZNF865) or fragment thereof. Disclosed are polynucleotides capable of encoding a polypeptide comprising two heterologous polypeptide domains, wherein the first polypeptide domain comprises a Cas protein and wherein the second polypeptide domain comprises ZNF865 or fragment thereof. Disclosed are vectors comprising one or more of the polynucleotides. Disclosed are methods of using the disclosed polypeptides, polynucleotides and vectors.

The application discloses application of a CCHC type zinc finger protein PbrZFP719 gene in promoting pear pollen tube growth and belongs to the technical field of plant genetic engineering. The application clones the gene PbrZFP719 from 'yellow flower pear' pollen by using a plant gene cloning technique, the nucleotide sequence of the gene is shown in SEQ ID No. 1, and the amino acid sequence coded by the gene is shown in the sequence table SEQ ID No. 2. Research shows that the PbrZFP719 gene can promote pear pollen tube growth, the change of PbrZFP719 gene expression is related to the change of ROS level and cellulose content at the top of the pollen tube, and meanwhile, the PbrZFP719 gene also participates in the regulation mechanism of self-incompatibility reaction. The pollen magnetic transfection technology is used to study the function of the gene in the pollen tube, and provides a wide application prospect for improving pollination efficiency.

Provided herein are zinc finger peptides comprising the amino acid sequence of SEQ ID NO: 1 (SDGDWICPDKKCGN-VNFARRTSCNRCGREKTT) and at least one substitution compared to SEQ ID NO: 1, wherein the zinc finger peptide is an engineered zinc finger peptide.

The invention discloses application of a tomato gene SlZFP2 as a negative regulation factor in regulation of plant cold resistance, belongs to the technical field of plant genetic engineering, and finds and confirms that the tomato zinc finger protein gene SlZFP2 is a key negative regulation factor of plant cold resistance for the first time. Experiments show that the expression of the SlZFP2 is induced by low temperature, the overexpressed transgenic tomato plant shows more serious cold injury symptoms under low temperature stress, the photosynthetic efficiency is reduced, active oxygen (H2O2 and O2-) is excessively accumulated, and the activity of antioxidant enzymes (SOD, POD and CAT) is weakened; the overexpression of the SlZFP2 can inhibit the biosynthesis and signal transduction of abscisic acid (ABA), and down-regulate the expression of cold response genes SlGRAS4 and SlCBF1; based on the discovery, the invention provides an application of using the SlZFP2 gene or an expression product thereof as a molecular marker for screening tomato materials with different cold resistance, creating a transgenic plant with reduced cold resistance by overexpressing the SlZFP2, and providing a recombinant DNA construct containing an SlZFP2 coding sequence and a host cell.

Disclosed are polypeptides useful in the treatment of diseases associated with pathogenic genomic repetitive sequences, such as neurological diseases. Nucleic acid molecules and vectors encoding such polypeptides are also disclosed. Also disclosed are therapeutic uses and methods of treating such diseases; in particular, the present invention relates to therapeutic uses and methods for the treatment of Friedel's Ataxia (FRDA). Also disclosed are methods and related peptides and nucleic acids for active, long-term delivery of therapeutic molecules to target cells in vivo or in vitro.

The present disclosure provides a compound having Formula (I '): or a pharmaceutically acceptable salt, hydrate, solvate, prodrug, stereoisomer, or tautomer thereof, wherein Rx, X1, X2, and R1 are as defined herein; and their use in the treatment of IKAROS family zinc finger 2 (IKZF2) dependent diseases. # imgabs0 #

Disclosed are compounds and salts thereof that bind to and modulate the activity of cereblon. In some embodiments, the binding and modulation of cereblon results in the degradation of IKAROS family zinc finger proteins (e.g., IKZF2). The compounds are represented by Formula I: TIFF2026502995000081.tif43170

The invention discloses application of a wild soybean zinc finger protein transcription factor encoding gene GsZFP4. The nucleotide sequence of the wild soybean GsZFP4 protein coding gene GsZFP4 is as shown in SEQ ID NO. 1. The wild soybean GsZFP4 protein coding gene GsZFP4 can be used And the constructed plant overexpression vector pBA002-GsZFP4 is transformed into the soybean, so that the expression vector pBA002-GsZFP4 is obtained. After the GsZFP4 is treated by the SMV strain SC7 for 21 days, the disease symptom of the GsZFP4 overexpressed soybean is obviously relieved, the SMV content is obviously reduced, and the GsZFP4 overexpressed soybean shows SMV resistance. In general, GsZFP4 may positively regulate and control the resistance of soybean to SMV.

The invention relates to an application of a zinc finger protein Zfp260 phosphorylation site for regulating osteogenesis, and particularly discloses an application of a biomarker in preparation of a medicine for regulating bone regeneration and repair, and the biomarker comprises one or a combination of more of Y173 phosphorylation, S182 phosphorylation and S197 phosphorylation of the zinc finger protein Zfp260. The invention finds that any phosphorylation defect mutation of the three sites Y173, S182 and S197 can obviously change the binding force and nuclear translocation signal with kinase PKC alpha, and each mutant cannot save the cell mineralization defect caused by Zfp260 knockout, and prompts that the newly found Zfp260 phosphorylation sites Y173, S182 and S197 play important roles in Zfp260 related diseases and the regulation process of promoting bone regeneration and repair.

Disclosed herein are polypeptides for use in treating diseases associated with pathogenic genomic repeat sequences, such as neurological disorders. Also disclosed are nucleic acid molecules and vectors that encode such polypeptides. Therapeutic uses and methods for treating such diseases are also disclosed; in particular, therapeutic uses and methods for treating Friedreich's ataxia (FRDA). Also disclosed is a method and associated peptides and nucleic acids for active, long-term delivery of therapeutic molecules to target cells in vivo or in vitro.