100 results about "Zinc finger" patented technology

The present disclosure generally relates to compounds that bind to and act as degraders of IKAROS family zinc finger (IKZF) proteins, such as IKZF2 (Helios) and / or IKZF4 (Eos). The present disclosure further relates to the use of the compounds for the preparation of medicaments for the treatment of diseases and / or conditions through the binding and degradation of IKZF proteins, such as IKZF2 and / or IKZF4, including cancer. The present disclosure provides compounds useful as degraders of IKAROS family zinc finger (IKZF) protein 2 (IKZF2; Helios). The present disclosure further relates to the use of the compounds for the treatment and / or prevention of diseases and / or conditions through the binding and degradation of IKZF2 proteins by the compounds.

The invention discloses application of a rice zinc finger protein OsRFI2 and a coding gene thereof in disease-resistant breeding, and belongs to the field of gene engineering. The rice zinc finger protein OsRFI2 is identified, the amino acid sequence of the rice zinc finger protein OsRFI2 is as shown in SEQ ID NO.2, and the nucleotide sequence of the coding gene OsRFI2 is as shown in SEQ ID NO.1. According to the invention, Zhonghua-11 rice is taken as a background, a knockout plant and an overexpression plant of the OsRFI2 gene are constructed, inoculation experiment results show that the scab length of the overexpression plant of the OsRFI2 gene is significantly smaller than that of the background plant, the overexpression of the OsRFI2 gene significantly improves the resistance of the rice plant to rice blast, and the rice zinc finger protein OsRFI2 positively regulates the disease resistance of the plant. The invention provides a new breeding strategy and a new breeding material for rice disease-resistant breeding, and has great economic benefits and wide application prospects for rice production.

The invention discloses a Pennisetum americanum transcription factor gene PgC3H11 for improving plant cold resistance and application thereof, and belongs to the technical field of gene engineering. The CDS sequence of the transcription factor gene PgC3H11 of the pennisetum americana is as shown in SEQ ID NO. 25. The zinc finger protein gene PgC3H11 is identified in pennisetum americana, the expression of the gene is induced by low-temperature stress, and the cold resistance of a transgenic plant can be enhanced by improving the expression level of the CBFs gene. The gene has important production value for improving the cold resistance of plants, creating excellent parent elements with high cold resistance and cultivating cold-resistant varieties.

Described herein are engineered nuclease enzymes comprising mutations in a cleavage domain (e.g., FokI or a homolog thereof) and / or a DNA binding domain (zinc finger protein, TALE, single guide RNA) such that target specificity is increased.

The invention provides a retrotransposase, which comprises a target DNA binding structural domain containing a zinc finger binding motif, a reverse transcriptase structural domain and an endonuclease structural domain, and can be used for reversely transcribing RNA (Ribonucleic Acid) into DNA. The amino acid sequence of the retrotransposase is shown as any one of SEQ ID No.1 to 6 or SEQ ID No.32 to 43 or SEQ ID No.68 to 71 or has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% and 99% identity with the amino acid sequence of any one of SEQ ID No.1 to 6 or SEQ ID No.32 to 43 or SEQ ID No.68 to 71. The invention also relates to a system for modifying DNA. The system comprises the retrotransposase provided by the invention or a nucleic acid encoding the retrotransposase provided by the invention; and a donor RNA or a nucleic acid encoding the donor RNA, the donor RNA comprising: a sequence that binds to the retrotransposase and a heterologous sequence.

The use of a wild soybean zinc finger protein GsZFP4 or an encoding material thereof. The nucleotide sequence of a gene GsZFP4 which encodes the wild soybean zinc finger protein GsZFP4 is shown as SEQ ID NO. 1. A constructed plant over-expression vector pBA002-GsZFP4 is transformed into soybeans. After treatment with the SMV strain SC7 for 21 days, it is found that soybeans that over-express GsZFP4 have obviously relieved disease symptoms and remarkably reduced SMV content, and show resistance against SMVs. In general, GsZFP4 may positively regulate the resistance of soybeans against SMVs.

The present disclosure relates to dihydropyrimidine-2,4(1H,3H)-dione-containing polycyclic compounds, or pharmaceutically acceptable salts thereof, and compositions thereof which are effective to reduce or modulate widely interspaced zinc finger motifs (WIZ) protein expression levels and / or induce fetal hemoglobin (HbF) expression, and also relates to methods of their preparation and their use in treatment of subjects in need.

The invention discloses a biomarker for rapidly evaluating the radiation exposure dose of a human body and application of the biomarker. The biomarker is zinc finger matrix protein type protein 3 (ZMAT3). Compared with an existing biological dose estimation method, the method has the advantages of being simple, convenient, rapid, accurate and high in throughput, and is particularly suitable for radiation biological dose estimation of large population samples under nuclear and radiation accidents.

The invention discloses a brassica plant drought resistance negative regulation factor BnaA9.TZF5 and application of the brassica plant drought resistance negative regulation factor BnaA9.TZF5. The BnaA9.TZF5 is a transcription factor gene for coding CCCH type zinc finger protein in brassica napus, and a knockout plant obtained by performing targeted editing on the BnaA9.TZF5 through CRISPR / Cas9 shows that the drought resistance is remarkably enhanced along with phenotypic changes such as increase of leaf epidermis wax deposition and reduction of water loss rate; and an overexpression plant of the gene shows that the wax is reduced, the water loss is accelerated and the drought resistance is weakened, so that the BnaA9.TZF5 is a negative regulation factor for the drought resistance of the brassica plant. The BnaA9.TZF5 gene expression is knocked out to improve the drought resistance of brassica plants, the BnaA9.TZF5 gene can be used for molecular breeding of crops such as brassica napus, Chinese cabbage, cabbage and mustard, and a novel drought-resistant improved target gene is provided.

Provided herein, inter alia, are compositions for treating Human T-cell lymphotropic virus type 1 (HTLV-1) associated diseases. The compositions include a protein having a zinc finger domain capable of binding a sequence within an HTLV-1 long terminal repeat (LTR). Further provided are methods of treating HTLV-1 associated diseases in a subject in need thereof. The methods include administering to the subject the protein including the zinc finger domain, or a nucleic acid encoding the protein.

Fusion proteins comprising a DNA binding domain, e.g., a TAL effector repeat array or zinc finger, and a catalytic domain comprising a sequence that catalyzes hydroxylation of methylated cytosines in DNA, and methods of use thereof.

Methods and compositions for treating a corneal wound and / or increasing a population of limbal epithelial stem cells (LESCs) and / or early transit amplifying cells (eTAs) in the limbal epithelium of a subject in need thereof. The methods can include administering a therapeutic agent to the subject that: i) results in an increase in concentration of IFITM1 (Interferon Induced transmembrane Protein 1) in the limbal epithelium of the subject; and / or ii) results in a decrease in concentration of OVOL1 (Ovo Like Zinc Finger 1) in the limbal epithelium of the subject. Also provided are adeno-associated viruses (AAVs). The AAVs comprise a heterologous nucleic acid sequence encoding IFITM1 or a variant thereof, operably linked to a regulatory sequence.

Compositions and methods are provided for introducing transgenic target sites for Site Specific Integration (SSI) and / or polynucleotides of interest into at least one double-strand break target site of a double-strand-break inducing agent in a genomic window of a plant genome. Also provided are methods and compositions for producing a complex trait locus in a genomic window of a plant comprising at least one transgenic target site for site specific integration integrated in at least double-strand-break target site. The double-strand-break target site can be, but is not limited to, a target site for a zinc finger endonuclease, an engineered endonuclease, a meganuclease, a TALENs and / or a Cas endonuclease. The genomic window of said plant can comprise at least one genomic locus of interest such as a trait cassette, a transgene, a mutated gene, a native gene, an edited gene or a site-specific integration (SSI) target site.

The invention belongs to the technical field of plant heredity and genetic engineering, and particularly relates to a cold-resistant and bolting-resistant related gene BraTZF3 of Chinese cabbage and application of the cold-resistant and bolting-resistant related gene BraTZF3. A stress-related transcription factor BraA01g008400.3 C is screened by combining a yeast stress library screening technology with transcriptome analysis, the stress-related transcription factor BraA01g008400.3 C belongs to a co-tandem C3H type zinc finger protein and comprises a C-x8-C-x5-C-x3-H zinc finger (ZNF) structural domain, and tests prove that the BraTZF3 is positively correlated to low-temperature stress response and cold resistance, and the BraA01g008400.3 C can be used for preparing the stress-related transcription factor BraA01g008400.3 C. According to the present invention, the BraTZF3 is subjected to heterologous overexpression to positively regulate the cold resistance and the bolting resistance of arabidopsis thaliana, such that the gene provides the positive regulation effect on the cold resistance and the bolting resistance of the plant, especially the Chinese cabbage, and the new tool and the new method are provided for improving the cold resistance and the bolting resistance of the crop by using the gene engineering means so as to provide the good practical application value;

The application discloses application of a CCHC type zinc finger protein PbrZFP719 gene in promoting pear pollen tube growth and belongs to the technical field of plant genetic engineering. The application clones the gene PbrZFP719 from 'yellow flower pear' pollen by using a plant gene cloning technique, the nucleotide sequence of the gene is shown in SEQ ID No. 1, and the amino acid sequence coded by the gene is shown in the sequence table SEQ ID No. 2. Research shows that the PbrZFP719 gene can promote pear pollen tube growth, the change of PbrZFP719 gene expression is related to the change of ROS level and cellulose content at the top of the pollen tube, and meanwhile, the PbrZFP719 gene also participates in the regulation mechanism of self-incompatibility reaction. The pollen magnetic transfection technology is used to study the function of the gene in the pollen tube, and provides a wide application prospect for improving pollination efficiency.

Provided herein are zinc finger peptides comprising the amino acid sequence of SEQ ID NO: 1 (SDGDWICPDKKCGN-VNFARRTSCNRCGREKTT) and at least one substitution compared to SEQ ID NO: 1, wherein the zinc finger peptide is an engineered zinc finger peptide.

The invention discloses application of a tomato gene SlZFP2 as a negative regulation factor in regulation of plant cold resistance, belongs to the technical field of plant genetic engineering, and finds and confirms that the tomato zinc finger protein gene SlZFP2 is a key negative regulation factor of plant cold resistance for the first time. Experiments show that the expression of the SlZFP2 is induced by low temperature, the overexpressed transgenic tomato plant shows more serious cold injury symptoms under low temperature stress, the photosynthetic efficiency is reduced, active oxygen (H2O2 and O2-) is excessively accumulated, and the activity of antioxidant enzymes (SOD, POD and CAT) is weakened; the overexpression of the SlZFP2 can inhibit the biosynthesis and signal transduction of abscisic acid (ABA), and down-regulate the expression of cold response genes SlGRAS4 and SlCBF1; based on the discovery, the invention provides an application of using the SlZFP2 gene or an expression product thereof as a molecular marker for screening tomato materials with different cold resistance, creating a transgenic plant with reduced cold resistance by overexpressing the SlZFP2, and providing a recombinant DNA construct containing an SlZFP2 coding sequence and a host cell.

Disclosed are polypeptides useful in the treatment of diseases associated with pathogenic genomic repetitive sequences, such as neurological diseases. Nucleic acid molecules and vectors encoding such polypeptides are also disclosed. Also disclosed are therapeutic uses and methods of treating such diseases; in particular, the present invention relates to therapeutic uses and methods for the treatment of Friedel's Ataxia (FRDA). Also disclosed are methods and related peptides and nucleic acids for active, long-term delivery of therapeutic molecules to target cells in vivo or in vitro.

Disclosed are compounds and salts thereof that bind to and modulate the activity of cereblon. In some embodiments, the binding and modulation of cereblon results in the degradation of IKAROS family zinc finger proteins (e.g., IKZF2). The compounds are represented by Formula I: TIFF2026502995000081.tif43170

The invention discloses application of a wild soybean zinc finger protein transcription factor encoding gene GsZFP4. The nucleotide sequence of the wild soybean GsZFP4 protein coding gene GsZFP4 is as shown in SEQ ID NO. 1. The wild soybean GsZFP4 protein coding gene GsZFP4 can be used And the constructed plant overexpression vector pBA002-GsZFP4 is transformed into the soybean, so that the expression vector pBA002-GsZFP4 is obtained. After the GsZFP4 is treated by the SMV strain SC7 for 21 days, the disease symptom of the GsZFP4 overexpressed soybean is obviously relieved, the SMV content is obviously reduced, and the GsZFP4 overexpressed soybean shows SMV resistance. In general, GsZFP4 may positively regulate and control the resistance of soybean to SMV.

Provided herein are gene repressor systems comprising fusion proteins, such as fusion proteins comprising a DNA binding domain such as a TALE, zinc finger or catalytically-dead CRISPR protein and guid

The present disclosure provides methods and compositions for inactivating a glutamine synthetase (GS) gene. Zinc finger DNA-binding domains engineered to bind in a GS gene and fusion proteins comprising a zinc finger DNA-binding domain and a cleavage domain are provided herein. Methods of using the zinc finger proteins and fusions thereof to inactivate GS in a cell or cell line are also provided.

The present disclosure relates to the field of regulating Htt gene expression and HTT protein levels.

The invention discloses an application of corn E3 ubiquitinase in enhancing the resistance of corn to corn stem rot and drought. The name of the corn E3 ubiquitinating enzyme is ZmWIPF2, and the corn E3 ubiquitinating enzyme is shown as a sequence 2 in a sequence table. When the corn is subjected to abiotic stress such as drought and biological stress such as stem rot, the ZmWIPF2 cooperates with related genes to regulate and control the corn to resist the stem rot and drought and respond to pathogenic bacterium infection and drought stress. The ZmWIPF2 gene contains a zinc finger structural domain and an RING-H2 structural domain, wherein RING-Ubox is an E3 ubiquitin ligase. Transgenic material verification proves that the gene can improve the stress resistance of corn, has important significance for breeding stress-resistant corn varieties, and is suitable for wide popularization.

The present invention discloses a trifoliate orange cold-resistant gene CtrBBX32 and its application in genetic improvement of plant cold resistance. The CtrBBX32 gene is a gene of a subfamily of the zinc finger structural protein family isolated and cloned from the extremely cold-resistant citrus material trifoliate orange, and its sequence is shown in SEQ ID No. 1. Interference vectors and overexpression vectors are constructed with this gene, and it is introduced into trifoliate orange through genetic transformation mediated by Agrobacterium tumefaciens and Agrobacterium rhizogenes to obtain transgenic plants. Biological function verification shows that the cloned CtrBBX32 gene of the present invention has the function of regulating plant cold resistance. The discovery of this gene provides a new gene resource for plant stress resistance molecular design and breeding, and provides a new genetic resource for the implementation of green agriculture and water-saving agriculture. The development and utilization of this genetic resource is conducive to reducing agricultural production costs and achieving environmental friendliness.

The present disclosure discloses compounds that bind to and modulate the activity of cerebron, and salts thereof. In some embodiments, binding and modulation of cerebron results in degradation of the IKAROS family zinc finger protein (e.g., IKZF2). The compounds have Formula I: Formula I:

An application of Zfp217 gene in preparing medicines for treating osteoporosis is provided. The present disclosure provides a method for treating osteoporosis by inhibiting an expression of Zfp217 gene. A reagent for inhibiting the expression of Zfp217 gene includes an aptamer for inhibiting the expression of Zfp217 gene in bone marrow mesenchymal stem cells.

An embodiment provides a method for using a zinc finger protein in the selective recovery of metal ions included in various types of industrial waste, and provides: a PARIS zinc finger domain having an amino acid sequence of SEQ ID NO: 1; a composition for adsorbing and recovering cobalt ions, comprising the PARIS zinc finger domain as an active ingredient; and a method for recovering cobalt ions, comprising a step of culturing, in a material comprising waste cobalt, E. coli into which the PARIS zinc finger domain has been introduced.

Use of a Glycine soja zinc finger protein 4 (GsZFP4) or a genetic material thereof are provided. A gene GsZFP4 encoding the GsZFP4 has the nucleotide sequence of SEQ ID NO: 1. A constructed plant overexpression vector pBA002-GsZFP4 is transformed into soybean. After 21 d of treatment with an SMV strain SC7, it is found that disease symptoms in the soybean overexpressing GsZFP4 are significantly alleviated and the SMV content is significantly reduced, demonstrating resistance to the SMV. In summary, the GsZFP4 may positively regulate soybean resistance to the SMV.

The application relates to the technical field of agricultural bioengineering, and particularly provides application of a rice CONSTANS-LIKE 5 gene and an interaction protein OsIDS1 in regulating a rice heading stage. The CONSTANS-LIKE 5 gene is cloned from rice Nipponbare NIP, is a transcription factor protein with 372 amino acids, and belongs to the CCT / B-box zinc finger protein family. Through a genetic transformation experiment, it is proved that overexpression of the CONSTANS-LIKE 5 gene promotes rice heading under short-day conditions, and knockout or silencing of the CONSTANS-LIKE 5 gene inhibits rice heading under short-day conditions; overexpression of the OsIDS1 gene inhibits rice heading under short-day conditions, and knockout or silencing of the OsIDS1 gene promotes rice heading under short-day conditions.