37results about How to "Broad antimicrobial spectrum" patented technology

The invention discloses children antimicrobial peptides cathelicidins, a preparation method and the applications thereof. The nucleotide sequence and the amino acid sequence of children antimicrobial peptides Cathelicidin1, Cathelicidin2 and Cathelicidin3 are shown as a sequence table. The preparation method of the antimicrobial peptides adopts a solid-phase chemical synthesis method or a geneticengineering method. The genetic engineering method comprises the following steps of: respectively cloning the encoding genes of mature children antimicrobial peptides Cathelicidin1-3 to expression vectors; and then, guiding into host cells to express. By applying the genetic engineering technology in the invention, the children antimicrobial peptides Cathelicidins are expressed in the prokaryotichost cells with high efficiency. Proved by experiments, the antimicrobial peptides have obvious inhibition on various gram-positive bacteria and negative bacteria.

The invention discloses a group of Cathelicidins antimicrobial peptides of chicken, a preparation method and an application thereof. The nucleotide sequences and amino acid sequences of Cathelicidin 1 and Cathelicidin 3 antimicrobial peptides of the chicken are presented in a sequence table. The preparation method of the antimicrobial peptides is a solid phase chemical synthesis method or a gene engineering method, wherein the gene engineering method includes that coding genes of mature peptides of the Cathelicidin 1 and 3 antimicrobial peptides of the chicken are cloned on expression vectors respectively and then led to host cells for expression. According to the group of antimicrobial peptides, the preparation method and the application thereof, the Cathelicidins antimicrobial peptides of the chicken are efficiently expressed in pronucleus host cells by using the gene engineering technology, and experiments prove that the group of antimicrobial peptides has obvious inhibiting effects on a plurality of gram-positive bacteria and gram-negative bacteria.

This invention relates to novel aminoglycoside antibiotics, which have potent antimicrobial activity against bacteria, which induce infectious diseases, particularly MRSA, and has no significant nephrotoxicity, and process for producing them. More particularly, the present invention relates to compounds represented by formula (Ia) or their pharmacologically acceptable salts or solvates, or their diastereomer mixtures, antimicrobial agents comprising them, and a process for producing them.

The invention belongs to the field of biotechnology and particularly relates to pichia pastoris expressed recombinant chicken Cathelicidin antibacterial peptide and further discloses a preparation method and application thereof. In the method for preparing recombinant chicken Cathelicidin antibacterial peptide disclosed by the invention, a pPICZalphaA secreted expression vector is selected as a eukaryotic expression system of the exogenous gene so that the recombinant chicken Cathelicidin antibacterial peptide is efficiently expressed and direct killing of host cells caused by the expression product is avoided. Meanwhile, the method has the advantages of high expression efficiency, simple separation and purification of expression products, low production cost, easiness in magnification and good stability and is suitable for large-scale industrial production. According to experimental verification, the combination of Cathelicidin antibacterial peptide and antibiotic realizes an obvious synergistic antibacterial effect on multiple kinds of gram-positive bacteria and gram-negative bacteria, and the application and promotion prospects are broad.

The invention relates to bullfrog antibiotic peptide temporin-Lb, genes thereof and the application in the pharmacy, belonging to the biomedicine field. The bullfrog antibiotic peptide genes are obtained by filtering in a constructed bullfrog skin c DNA library; wherein, the molecular weight is 1691.11 dalton; the isoelectric point is 9.70; the primary structure of the complete sequence of the polypeptide is Leu Phe Arg His Val Val Lys Ile PheGIu Lys Tyr Leu-AMIDATION. The genes of the coding bullfrog antibiotic peptide are composed of 322 position nucleotide acid; wherein, the coding mature peptide is 142nd-180th position nucleotide acid. The synthetic bullfrog antibiotic peptide has obvious function of inhibiting the growth of the bacterial and fungus and can be taken as therapeutic drug for preparing pathogenic microorganism infection diseases to be applied.

A compound represented by formula (I) or a pharmaceutically acceptable salt thereof wherein A represents a group represented by one of formulae (i)-(iii); B represents a group represented by formula (v) or (vi); and E represents a substituted or unsubstituted heterocyclic group having a cationic nitrogen atom.

The invention relates to a hylarana guentheri secretory peptide, a gene thereof and applications of the secretory peptide in pharmacy. The secretory peptide is an annular polypeptide formed by 43 amino acids. The amino acid sequence of the secretory peptide is shown as SEQ ID NO.1, and cysteine at the number 37 site and cysteine at the number 43 site form an intramolecular disulfide bond. The gene sequence of the secretory peptide is shown as SEQ ID NO.4, wherein the number 133 to number 261 nucleotides encode a functional mature hylarana guentheri secretory peptide. A mature functional polypeptide amino acid sequence is induced from the gene of the hylarana guentheri secretory peptide. The synthesized hylarana guentheri secretory peptide has high anti-bacterial, anti-influenza virus and antioxidant functions. The hylarana guentheri secretory peptide has characteristics of a simple structure and convenient artificial synthesis, and can be applied in medicines treating pathogenic microorganism infectious diseases and diseases caused by radical oxidation, beautifying and skincare medicines and food additives.

The invention discloses a non-finger frog skin peptide and gene and application in the drug in the biological medical domain, which codes a single-chained peptide with molecular weight at 3355.95 and isoelectric point at 10.14, wherein the primary structure of peptide is Gly Leu Gly Gly Ala Lys Lys Asn Phe Ile Ile Ala Ala Asn Lys Thr Ala Pro Gln Ser Val Lys Lys Thr Phe Ser Cys Lys Leu Tyr Asn Gly; the gene of secretory peptide is composed of 731 nucleic acids, which codes 520-616th nucleic acid; the peptide possesses obvious bacteria and fungi inhibiting action, which can be applied to make microbe infection disease drug.

The invention discloses a chicken Cathelicidins antibacterial peptide and a preparation method and application for the same. A nucleotide sequence of Cathelicidins 1 and a nucleotide sequence of Cathelicidins 2 of the chicken antibacterial peptide are shown in a sequence table. The preparation method for the antibacterial peptide is solid-phase chemical synthesis or a genetic engineering method. The genetic engineering method includes respectively cloning coding genes of mature peptides of the Cathelicidins 1 and coding genes of mature peptides of the Cathelicidins 2 of the chicken antibacterial peptide on expression vectors; and leading the expression vectors into host cells for expression. A genetic engineering technology is applied to efficiently express the chicken Cathelicidins antibacterial peptide in the host cells of a pronucleus, and as proved by experiments, the antibacterial peptide has an obvious suppression effect on various gram-positive bacteria and gram-negative bacteria.

The invention discloses an ophthalmic gel medicinal composition and a preparation method thereof. The medicinal composition containing tobramycin and dexamethasone, disclosed by the invention, has the effect of treating anterior uveitis and keratitis; the ophthalmic gel medicinal composition is prepared through a scientific and reasonable production process; and the product is definite in function, controllable in quality and safe to take. The preparation method of the medicinal composition is simple, and the preparation process can be finished by conventional equipment.

The invention belongs to the biotechnology field, particularly relates to a pichia pastoris-expressed recombinant chicken antibacterial peptide Cathelicidin 2, and further discloses a preparation method and application thereof.According to the preparation method of the recombinant chicken antibacterial peptide Cathelicidin 2, pPICZ alpha A secreting type expression vector is selected as an eukaryotic expression system of exogenous genes, the recombinant chicken antibacterial peptide Cathelicidin 2 is effectively expressed, and direct destruction caused by an expression product on host cells is avoided.Meanwhile, the method is high expression efficiency, the expression product is easy to separate and purify, the production cost is low, enlarging is easy, stability is good, and the method is suitable for large-scale industrial production.Experiments prove that the antibacterial peptide Cathelicidin 2 has the obvious synergistic antibacterial effect when used in cooperation with antibiotics, and has the wide application and popularization prospect.

The invention provides an antibacterial compound of formula (I) or a salt thereof, as well as an antibacterial compound of formula (II) or a salt thereof, wherein R¹, R², W, X, Y and n have any of the values defined in the specification.

The present invention relates to compounds of formula (I) and a process for producing the same. In formula (I), X represents a halogen atom, and R¹ represents group —COR² wherein R² represents group OM or C1-12 alkyloxy wherein M represents a hydrogen atom, an alkali metal, an alkaline earth metal, or quaternary ammonium. The use of this compound as a synthetic intermediate can realize the production of carbapenem derivatives having potent antimicrobial activity in an efficient and safe manner at low cost.

The invention relates to a filter material, the filter material comprises an internal filter core material and a coating layer coated on the outer layer of the filter core material, and the coating layer is selected from one or more of copper, silver, zinc and gold and one or more alloys of the copper, the silver, the zin and the gold. The invention also relates to a filter article comprising the filter material. The filter material disclosed by the invention has the effects of quickly, efficiently and lastingly killing microorganisms and having a wide antimicrobial spectrum.

Provided is an antimicrobial peptide Sparamosin from Scylla paramamosain. The Sparamosin mature peptide and its functional domain Sparamosin_26-54 were synthesized by solid-phase synthesis with a purity of over 95%. Both Sparamosin and Sparamosin_26-54 exhibit strong antimicrobial activity. More importantly, Sparamosin_26-54 has strong antifungal activity and could inhibit the growth of a variety of yeasts and filamentous fungi. Based on the potent antimicrobial activities of Sparamosin and Sparamosin_26-54, both peptides could be developed as alternatives for conventional antibiotics, antimicrobial agents, feed additives in aquaculture and livestock, preservatives, and mold inhibitors.

The invention discloses a non-finger microbe-proof peptide and gene and application in the drug in the biological medical domain, which codes a single-chained peptide with molecular weight at 3355.95 and isoelectric point at 11.47, wherein the primary structure of peptide is Gly Leu Phe Thr Leu Ile Lys Gly Ala Ala Lys Leu Ile Gly Lys Thr Val Pro Lys Lys Gln Ala Arg Leu Gly Met Asn Leu Trp Leu Val Lys Leu Pro Thr Asn Val Lys Thr (GLFTLIKGAAKLIGKTVPKKQARLGMNLWLVKLPTNVKT); the gene of secretory peptide is composed of 343 nucleic acids, which codes 123-240th nucleic acid; the peptide possesses obvious bacteria and fungi inhibiting action, which can be applied to make microbe infection disease drug.

The invention provides a sequence of an artificially designed and synthesized antibacterial peptide and a preparation method thereof, and further provides application of the antibacterial peptide with different configurations to microorganism resistance. The antibacterial peptide disclosed by the invention has a remarkable effect of inhibiting the growth of bacteria and fungi. The antibacterial peptide disclosed by the invention has the beneficial characteristics of simple structure, artificial synthesis convenience and wide antibacterial spectrum; the full D-type and basic amino acids are composed of D-type amino acids, and the molecules have the characteristics of tolerance on degradation of various proteases, long antibacterial activity retention time and no drug residue; and the compound can be applied to prevention and treatment of infectious diseases of human or animals, artificial biological materials, food preservation, fruit and vegetable preservation and feed additives.