694 results about "Esophagus Cancers" patented technology

The invention relates to a Chinese medicinal preparation for treating cancer, and the Chinese medicinal preparation is prepared from 110 raw material drugs, such as yew, barbed skullcap herb, hairyvein agrimony and laggera pterodonta. The preparation can be oral solution, granules, powder, capsules, electuary and tablets. 110 Chinese medicaments are adopted, and monarch, minister, assistant and guide drugs are reasonably compatible and are comprehensively taken to play the effect of treating both principal and secondary aspect of cancers. The raw material drugs adopted in the Chinese medicinal preparation are common Chinese medicaments, and are low in manufacture cost and small in side effect. The medicament has the advantages of capabilities of effectively strengthening the body immunity and attacking pathogen without hurting a body along with quick response, high curative rate, high heal rate, low relapse rate, treatment of both principal and secondary aspect of cancers, safety and reliability, and can be used for treating various types of cancers, especially lung cancer, gastric cancer, liver cancer, esophagus cancer, pancreatic cancer, cervical cancer and breast cancer.

The invention belongs to the field of molecular biology, and particularly relates to a method for CRISPR/Cas9 targeted knockout of a human ezrin gene enhancer key region and specific gRNA thereof. In the method, according to the design principle of CRISPR/Cas9, two target sites are designed at the upstream and the downstream of the human ezrin gene enhancer key region, corresponding oligonucleotide sequences are synthesized and then connected to a carrier pX459 to construct recombinant plasmids, the recombinant plasmids are transfected with a human esophagus cancer cell line, and then specific knockout of the human ezrin gene enhancer key region can be achieved. The method and the specific gRNA have great significance for study on clinical tumor therapy with the human ezrin gene enhancer as the target.

The invention provides novel compositions, methods and uses, for the diagnosis, prognosis, prediction, prevention and aid in treatment of malignant neoplasia such as breast cancer, ovarian cancer, gastric cancer, colon cancer, esophageal cancer, mesenchymal cancer, bladder cancer or non-small cell lung cancer. Genes that are chromosomally amplified in breast tissue of breast cancer patients are disclosed. Further disclosed are chromosomally amplified genes and non-amplified genes that correlate to Taxane resistance, Taxane benefit or adverse Taxane reaction, which can be used as an aid to make therapy dicisions.

The invention provides brefeldin A ester derivatives having antitumor activity and their preparation method and use. The brefeldin A ester derivatives have structures shown in the structural general formula (I). The brefeldin A ester derivatives have high effects on esophagus cancer, lung cancer, kidney cancer, colorectal cancer and prostatic cancer and have an in-vitro detection effective inhibition rate of 80%. The preparation method of the brefeldin A ester derivatives has simple processes and can be operated easily.

The invention relates to the field of culture of tumor organoids, and in particular relates to a special medium used for in-vitro culture of esophagus cancer tumor organoid based on human esophagus cancer tissue and a culture method. The special medium comprises a receptor tyrosine kinase ligand, an Rho-associated coiled-coil protein kinase inhibitor, vitamin and hormone, an antioxidant, and an agonist for inhibiting cell differentiation pathway. According to the method, through the step-by-step culture technology adopting conditional dedifferentiation, tumor cells rapidly amplify within a short time to form the organoid. Through the step-by-step culture technology, primary cells rapidly form the organoid, meanwhile, adequate cells are formed within the effective time, so that the follow-up experiment operation can be conveniently carried out, and therefore, the culture speed and success rate of the organoid are improved.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The invention discloses a cancer pain-relieving plaster prepared by a preparation A and a preparation B, wherein the preparation A is prepared by five branches, five skins, one brick, one stone, five cores, and the like; the preparation B is prepared by poria cocos, pinellia ternate, jackinthepulpit tuber rhizome, trichosanthes kirilowii maxim, centipede, zaocys dhumnade, and the like. When the cancer pain-relieving plaster is prepared, the preparation B is added into the preparation A to be decocted for 4.5-5.5 hours, red lead is added to be mixed to pasty fluid, then cold water is added for steeping to releasing fire-toxin, water is changed once one day, and the plaster is obtained after steeping for 7 days. When the plaster is used, the plaster is coated on cotton cloth or plaster paster. The cancer pain-relieving plaster mainly aims at tumour cancers of lung cancer, gastric cancer, liver cancer, pancreatic cancer, colon caner, rectal caner, kidney cancer, bladder caner, breast cancer, cervical cancer, ovarian cancer, esophagus cancer, laryngeal cancer, and the like and is obvious in pain-relieving effect.

Described herein are platinum-based brush-arm star polymers (Pt-BASPs), or a pharmaceutical composition thereof, for delivery of platinum-based agents, such as cisplatin. Also provided are methods and kits involving the Pt-BASPs, or a pharmaceutical composition thereof, for treating proliferative diseases such as cancers (e.g., lung cancer, head-and-neck cancer, esophagus cancer, stomach cancer, breast cancer, pancreas cancer, liver cancer, kidney cancer, or prostate cancer) in a subject.

The invention discloses a diagnosis marker suitable for an early-stage esophageal squamous cell cancer diagnosis and a screening method of the diagnosis marker. Twenty five kinds of serum metabolic markers and ten relevant metabolic pathways are discovered; through the combination of the twenty five kinds of serum metabolic markers, the diagnosis marker used for an esophagus cancer diagnosis can be obtained. The screening method of the diagnosis marker has high operability; the diagnosis marker can be used for building a diagnosis model; the diagnosis model has the advantages of good effect, high sensitivity and good specificity, is suitable for a late-stage esophagus cancer diagnosis and is also suitable for the early-stage esophagus cancer diagnosis. The diagnosis model built by adopting the diagnosis marker provided by the invention has the advantages that the diagnosis can be realized only through blood sampling; the noninvasive effect is achieved; the cost is low; the modern internal invasive diagnosis mode can be well replaced; the pain of a patient is greatly reduced; in addition, the diagnosis speed is high; convenience is realized; the required time is short; the work efficiency is improved; the early discovery and early treatment of an esophagus cancer can be favorably realized; good clinic use and popularization value is realized.

The invention discloses a segmentation method for esophagus cancer in chest CT images. According to the method, first, multiple groups of CT images containing the esophagus cancer are selected, and the CT images containing the esophagus cancer are used as training samples; the selected CT images are preprocessed, esophagus cancer features are acquired, and the images obtained after feature description is performed are used as training data; an esophagus cancer semantic segmentation model based on a full-convolution neural network is established, described esophagus cancer features are used asfeature input of the full-convolution neural network to serve as learning samples for training, and an esophagus cancer segmentation network model is obtained; three-dimensional reconstruction is performed on the esophagus cancer, wherein three-dimensional reconstruction and analysis are performed on an esophagus cancer segmentation result obtained through the obtained esophagus cancer segmentation network model, and esophagus cancer image omics parameters under a three-dimensional space are obtained; and the obtained esophagus cancer image omics parameters are visually displayed. The method is small in model scale, high in speed and high in accuracy.

The invention relates to the field of organic synthesis and medicine, and discloses a preparation method for N-substituted methyl-3,5-disubstituted benzylidene base-4-piperidone and biological activity for efficiently inhibiting cell line proliferation such as leukemia, ovarian cancer, breast cancer, liver cancer and esophagus cancer. The method includes: starting from various substituted methylamine and methyl acrylate, sequentially going through Michael addition, Dieckmann condensation, acidolysis and decarboxylation to obtain N-substituted methyl-4-piperidone, and subjecting the N-substituted methyl-4-piperidone to aldol reaction with substituted benzaldehyde to obtain a target compound N-substituted methyl-3,5-disubstituted benzylidene base-4-piperidone. The target compound can selectively and efficiently inhibit cell line proliferation such as leukemia, ovarian cancer, breast cancer, liver cancer and esophagus cancer, and activity of inhibiting carcinoma cell line proliferation is obviously higher than conventional chemotherapeutic 5-fluorouracil.

The invention provides a biomarker compound for early diagnosing esophagus cancer and specifically provides a characteristic polypeptide compound capable of passing mass spectrum detection. The compound comprises three polypeptides at the mass-to-charge ratio of 1925.5m/z, 2950.6m/z and 5900.0m/z. When the 2950.6m/z and 5900.0m/z polypeptides are subjected to up-regulation expression and 1925.5m/z polypeptide is subjected to down-regulation expression, the subject is confirmed as an esophagus cancer patient or a potential esophagus cancer patient. The biomarker provided by the invention can be used for early diagnosing and screening the esophagus cancer; the method is simple, easy in operation and high in accuracy; a new method and thought for early diagnosing and screening the esophagus cancer are supplied; and meanwhile, the invention also discovers that thrombin sensitive protein 1 (TSP1) can be singly taken as a biomarker used for diagnosing the esophagus cancer or forecasting the prognosis of the esophagus cancer in serum or tissue.

The present invention is solid tumor treating medicine composition and belongs to the field of medicine technology. The medicine composition contains melphalan in effective anticancer amount and medicinal supplementary material. The medicinal supplementary material is mainly biocompatible, degradable and absorbable polymer, and during the degradation and absorption of the polymer, melphalan is released slowly to local tumor part to lower the systemic toxic reaction and to maintain local medicine concentration. The present invention has enhanced treating effect. The solid tumor includes cerebral tumor, liver cancer, lung cancer, esophagus cancer, gastric cancer, etc.

Described herein are platinum-based brush-arm star polymers (Pt-BASPs), or a pharmaceutical composition thereof, for delivery of platinum-based agents, such as oxaliplatin. Also provided are methods and kits involving the Pt-BASPs, or a pharmaceutical composition thereof, for treating proliferative diseases such as cancers (e.g., lung cancer, head-and-neck cancer, esophagus cancer, stomach cancer, breast cancer, pancreas cancer, colorectal cancer, liver cancer, kidney cancer, or prostate cancer) in a subject.

The invention discloses a detection method in the technical field of biological engineering and relates to a method for employing double indicatrix immunochromatography by semi-quantity to diagnose carcinoembryonic antigen in particular. The carcinoembryonic antigen is a broad-spectrum tumor marker, can reflect the existences of multi-tumors to people and is a better tumor marker for curative effect judgment, disease development, monitoring and preoperative prognosis on colorectal cancer, breast cancer and lung cancer. Clinic detection on CEA (carcinoembryonic antigen) is usually served as a detection criterion for the early aided diagnosis and cancer postoperation recrudescence of colon cancer, gastric cancer, esophagus cancer, rectal cancer, etc. At present, common CEA detection methods on clinic detection comprise ELISA (enzyme-linked immuno sorbent assay), CLIA and so on, waste time and labor, is not beneficial to popularization and has high cost. The technology of immune collaurum develops rapidly and is applied widely to the detection on infectious diseases, early pregnancy, cancer and the like. The method adopts the collaurum immune chromatography to build a method for quickly detecting the CEA, and can detect the range of a CEA gray area from 5ng/mL-20ng/mL with semi quantity. The CEA can be taken as the basis for differential diagnosis of benign and malignant tumors.

The invention provides a Chinese drug for curing the oesophagus cancer, which comprises a Chinese drug A and a Chinese drug B. The Chinese drug A adopts a hard honeyed pill which is prepared by bornel, cow bezoar, arenobufagin, agalloch, musk, saliter, sal ammoniac, pearl, chlorite schist, asafetida and notoginseng according to a certain proportion by weight, and the Chinese drug B adopts soft honeyed pill which is prepared by Chinese angelica root, root of herbaceous peony, safflower, rhizoma chiuanxiong, burred tuber, zedoary, pinellia, aucklandia root, amomum fruit, corydalis tuber, bitter orange, cuttlebone, barbed stullcap, oldenlandia, arrowhead, aloe, ginseng, atractylodes macrocephala, dried rehmannia root and licorice root according to a certain proportion by weight, and the Chinese drug A and B are separately packed and used together. The Chinese drug for curing the oesophagus cancer has good effects on curing middle-advanced oesophagus cancer, curing hiccought, relieving obstruction and restraining and killing cancer cells.

The invention relates to an anti-tumor medicine, which is prepared by Chinese medicine raw materials. The composition and the weight ratio of the Chinese medicine raw materials are codonopsis pilosula 30-100 parts, fructus ligustri lucidi 20-40 parts, orange peel 20-40 parts, chrysanthemum 30-50 parts, paris polyphylla 10-20 parts, dandelion 20-30 parts, patrinia 15-25 parts, snakeskin 15-25 parts, schizonepeta 30-45 parts, red flowers 15-25 parts, potentilla discolor 3-11 parts and fructus forsythiae 0.2-0.8 part. The anti-tumor medicine has a comprehensive formula, brings out the best in each other, strengthens the body resistance, cultures the basis, repairs tissue cells and enables the cells to be regenerated, reverses disease cells to be normal, can effectively treat malignant tumor including long cancer, esophagus cancer, intestinal cancer, bladder cancer, breast cancer, ovarian cancer, lymph cancer, uterine cancer and the like. The Chinese medicine is convenient to manufacture and use, safe, has no side and toxic effect, and is an ideal anti-tumor medicine.

The invention relates to a dry powder inhaler with a constituent rubescensin A as well as a preparation method and application thereof. The dry powder inhaler is a medicinal composition formed by mixing the constituent rubescensin A as an active constituent with pharmaceutically acceptable excipients. Compared with orally administrated medicines, the dry powder inhaler developed by using the technical scheme provided by the invention greatly improves the effect of the constituent rubescensin A on treating esophagus cancers, lung tumors and leukemia.