110 results about "Intrathecal use" patented technology

The invention provides a ziconotide nasal-brain delivery preparation which is high in brain targeting, safe and noninvasive and directly enters the brain through nasal administration. The nasal-brain delivery preparation comprises an active component ziconotide and an absorption enhancer, wherein the absorption enhancer is selected from one or more of dodecyl-beta-D-maltoside (DDM), menthol, hydroxypropyl-beta-cyclodextrin (HP-beta-CD), sodium glycocholate (SGC) and related derivatives thereof. The absorption enhancer with a specific type and content and the ziconotide cooperate and act together, so that the ziconotide bypasses a blood brain barrier, enters the brain through a nasal olfactory mucous membrane, forms a medicine storage bank in an olfactory bulb, is slowly released to the brain and keeps a long-term medicine effect, and therefore, a traditional ziconotide intrathecal administration mode is abandoned; the ziconotide nasal-brain administration mode is created, and the ziconotide nasal-brain administration method is a new-generation therapy for pain diseases related to the central nervous system.

A blood pump assembly includes an introducer sheath with a proximal end and a distal end, a pump body which extends within the introducer sheath, and a catheter that interfaces with the pump body and extends proximally though the introducer sheath. In a rest state, the introducer sheath forms an oval cross-section sized to encompass the catheter and a medical device. In a constrained state when the pump body is within the introducer sheath, the cross-section of the introducer sheath is circular. The malleability of the introducer sheath allows larger medical devices to be passed through the introducer sheath, while still allowing other devices to be inserted through the introducer sheath after the pump has been guided through. A perimeter of oval cross-section of the introducer sheath is equal to the perimeter of the circular cross-section of the introducer sheath.

The invention discloses application of a cell surface adhesion molecule CD22 as a target spot in preparation of drugs for treating spinal cord injury related diseases. The change of gene expression in the glial scar formation process is represented by space transcriptome sequencing, and the specific expression of CD22 in the glial scar region is up-regulated. According to single cell sequencing, in-situ hybridization and immunohistochemistry, specific high expression CD22 of part of microglial cells in a glial scar area is found. CD22 is knocked out through a genetic means, and it is found that formation of glial scars after spinal cord injury is remarkably reduced through inhibition of CD22. Behavioral detection finds that the error rate of irregular horizontal ladders is remarkably reduced by inhibiting CD22, and fine movement recovery of hind limbs of mice after spinal cord injury is promoted. The siRNA specifically targeting CD22 is injected into the sheath, so that the expression of microglial cells CD22 is inhibited, the error rate of irregular horizontal ladders of hind limbs can be reduced, and the recovery of the fine movement function of the hind limbs of the mouse after spinal cord injury is promoted. The invention provides a new possibility for development of drugs for spinal cord injury and treatment of spinal cord injury.

A catheter assembly for performing a thrombectomy and methods of use, the catheter assembly including a catheter sheath and a dilation and capture assembly slidably positioned within the catheter sheath. The dilation and capture assembly includes a catheter having a balloon portion at a distal end of the catheter, and a retrieval basket. The balloon portion is selectively inflatable and deflatable between respectively a maceration orientation and a delivery orientation. The retrieval basket is deployable from a delivery configuration mounted to the balloon portion and a retrieving configuration axially displaced from the distal end of the catheter.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The invention provides application of PRP-Exos in preparation of a medicine for treating neuropathic pain, and relates to the technical field of clinical medicine. According to the invention, the treatment effect of PRP-Exos on neuropathic pain by inhibiting a TLR4 / NF-kappa B signal channel is clarified, a new thought is provided for clinical transformation, meanwhile, an intrathecal injection delivery mode is adopted, the limitation of low bioavailability of peripheral administration is overcome, meanwhile, the treatment effect is comprehensively verified through a behavioral-histological-molecular biological multi-modal evaluation system, and the application prospect is wide. The potential of the PRP-Exos in relieving the neuropathic pain is proved.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The utility model discloses a real-time positioning system for implanting a catheter in a potential guiding sheath. The real-time positioning system comprises a positioning electrode plate, a potential guiding instrument and a guide wire body, the positioning electrode plate comprises an adhesive tape adhered to the body of a patient and a plurality of electrode plates arranged on the adhesive tape; the potential guiding instrument comprises a shell, positive and negative electrodes, a current change display and a voltage and current regulator are arranged on the shell, and a current signal receiver and a signal amplifier are arranged in the shell; the guide wire body comprises an insulating sleeve and a metal guide wire arranged in the insulating sleeve, the front end and the rear end of the insulating sleeve are closed, and a plurality of through holes are formed in the side wall; the head end of the metal guide wire is exposed, and the other part is wrapped by the insulating layer. The positioning electrode plate and the wire guide body are respectively connected with positive and negative electrodes to form a closed loop. The intrathecal infusion system solves the problems that in the implantation operation process of the intrathecal infusion system, the position of the catheter needs to be adjusted in a perspective mode repeatedly, real-time monitoring cannot be achieved, and the developing quality is not high, operation precision and efficiency are improved, and the X-ray exposure amount of a patient is reduced.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

Abstract A blood pump assembly includes an introducer sheath with a proximal end and a distal end, a pump body which extends within the introducer sheath, and a catheter that interfaces with the pump body and extends proximally though the introducer sheath. In a rest state, the introducer sheath forms an oval cross-section sized to encompass the catheter and a medical device. In a constrained state when the pump body is within the introducer sheath, the cross- section of the introducer sheath is circular. The malleability of the introducer sheath allows larger medical devices to be passed through the introducer sheath, while still allowing other devices to be inserted through the introducer sheath after the pump has been guided through. A perimeter of oval cross­section of the introducer sheath is equal to the perimeter of the circular cross-section of the introducer sheath. Abstract circular cross-section of the introducer sheath. 20 26 20 47 20 18 J un 2 02 6 A b s t r a c t 2 0 2 6 2 0 4 7 2 0 1 8 J u n 2 0 2 6

The present disclosure provides a double-stranded siRNA with lipophilic modification. The modified siRNA molecules exhibit excellent in vivo distribution and delivery efficiency via intrathecal injection, intradermal injection, or other administration routes. The molecules effectively knock down target gene expression while maintaining good tolerability and safety. The present disclosure further provides a preparation method of siRNA with lipophilical modification, a pharmaceutical composition, and application of the same in the preparation of a medicament for treating a TNF-α-mediated disease or disorder.

This allows for the insertion of multiple medical devices into the patient's vascular system via a single access point through an introducer sheath. [Solution] The intravascular system includes an introducer sheath 104 having a lumen of fixed diameter, a first medical device 102, and a catheter 106 having a proximal end and a distal end coupled to the first medical device. When the catheter is placed within the introducer sheath, an annular gap is formed between the outer circumference of the catheter and the inner circumference of the lumen. The catheter is configured to take on different dimensional forms such that the size of the catheter and the annular gap are variable.

The invention relates to a flexible intravascular targeted delivery catheter which comprises a guide wire rapid exchange section, a puncture needle sheath and a catheter body which are connected in sequence. The guide wire rapid exchange section is located at the front end of the puncture needle sheath, a guide wire exchange channel of a micro guide wire is axially arranged in the guide wire rapid exchange section, and an inlet of the guide wire exchange channel is formed in the side wall of the end, close to the puncture needle sheath, of the guide wire rapid exchange section. A conveying pipe is arranged in the catheter body, and the front end of the conveying pipe is connected with three puncture needles which are evenly distributed in the circumferential direction and located in the puncture needle sheath. Three puncture needle outlets are evenly distributed in the side wall of the front portion of the puncture needle sheath in the circumferential direction. The side wall of the rear portion of the catheter body is connected with a side edge infusion tube, the rear end of the catheter body is connected with a puncture needle pushing device which drives the conveying tube to achieve forward pushing and backward withdrawing of the puncture needle, and the rear end of the conveying tube penetrates out of the rear end of the puncture needle pushing device and is provided with a tail end connector. The catheter can effectively overcome the inherent defects of most intravascular delivery catheters, and the performance quality of the intravascular delivery catheter and the effectiveness and practicability of clinical application are remarkably improved, so that the catheter shows more excellent technical advantages and clinical value in the field of vascular interventional diagnosis and treatment.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

Systems, methods, and devices are disclosed for administering a therapeutic agent to a patient and improving therapeutic effects of such agents on a patient. A stimulation is applied to a portion of a patient's spine, and the therapeutic agent is administered to the patient intrathecally and proximal to the portion of the patient's spine. In some embodiments, a second stimulation is applied to the patient at a second portion of the patient's spine and concurrently with administering the therapeutic agent. Concerted stimulation of the patient's spine administering a therapeutic agent synergistically improves treatment outcome.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The invention belongs to the technical field of medicine, and discloses application of SHLP2 in preparation of medicine for relieving and treating acute and chronic inflammatory pain, and the amino acid sequence of SHLP2 polypeptide is MGVKFFTLSTRFFPSVQRAVPLWTNS. After the SHLP2 polypeptide is treated in an intrathecal (5 [mu] g / 10 [mu] g / 20 [mu] g) injection mode, the SHLP2 polypeptide shows a good treatment effect in an acute inflammation pain model induced by formalin and capsaicin and a chronic inflammation pain model induced by carrageenan and a complete Freund's adjuvant. The SHLP2 is utilized to target a mitochondrial genome, the effect of relieving acute and chronic inflammatory pain is achieved in a central sheath injection mode, and a target different from a traditional analgesic drug can be searched for treatment of the acute and chronic inflammatory pain.

The invention discloses a lipophilic modified nucleic acid medicine composition and application thereof, the lipophilic modification is saturated or unsaturated C4-C30 alkyl, the composition comprises an absorption enhancer, and the method is that the lipophilic modified nucleic acid medicine is delivered to the brain through the nasal mucosa. Nucleic acid drugs are transmitted into the olfactory bulb region through a neural pathway, namely, cross-olfactory mucosa, bypass BBB and directly enter the brain, the drug concentration content of the olfactory bulb is far higher than that of other tissues of the brain, and the tissues except the olfactory bulb are uniformly distributed, so that the olfactory bulb can be used as a drug reservoir and gradually and slowly spread to the other tissues of the brain; the long-time drug effect can be maintained by one-time drug administration, so that the drug administration frequency can be reduced. Compared with intrathecal injection, by adopting the composition disclosed by the invention for nasal administration and using 1 / 2 of intrathecal administration dosage, the same intrathecal steady-state distribution as intrathecal distribution can be achieved, so that the method disclosed by the invention is safer, noninvasive and efficient.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

Bioadhesive and biodegradable polymeric nanoparticles can be administered intrathecally, for example, via the cisterna magna, into the spinal column to allow widespread distribution for the treatment of tumors such as leptomeningeal metastases. The nanoparticles rapidly spread to all cerebrospinal fluid (CSF) compartments, including the brain parenchyma and spinal column. The bioadhesive nanoparticles penetrate and are retained for long periods of time, during which time they can continue to release drugs. These nanoparticles can be loaded with different therapeutic, preventive, or diagnostic agents, most preferably DNA repair inhibitors, to enhance the killing of leptomeningeal tumors, such as leptomeningeal metastases, and disseminated tumors, such as medulloblastoma. In a preferred embodiment, patients are treated with a combination of a PARP inhibitor and temozolomide.

The application discloses application of an inhibitor targeting CCL28 in treatment of visceral pain. The application firstly proves that CCL28 is significantly up-regulated in spinal cord dorsal horn neurons of a mouse model of visceral pain, and establishes CCL28 as a new target for treatment of visceral pain. On this basis, the application designs and screens a high-efficiency and specific siRNA sequence targeting CCL28, the siRNA can be delivered to the spinal cord locally through intrathecal injection, specifically silences CCL28 gene expression, inhibits activation of a downstream ERK signal pathway, thereby significantly alleviating visceral pain, and has no obvious off-target effect. The application provides a complete technical scheme from target discovery to drug intervention, provides a new strategy and a drug candidate molecule for treatment of visceral pain, and has a good clinical application prospect.

The invention discloses an NIR-II region fluorescent probe suitable for intrathecal injection, a preparation method of the NIR-II region fluorescent probe and application of the NIR-II region fluorescent probe in cerebrovascular imaging, and belongs to the technical field of probe preparation. The problem of low resolution of current cerebrovascular imaging is solved. The rare earth nano fluorescent material is prepared into the NIR-II region fluorescent probe, delivery of large-size fluorescent imaging particles is achieved through intrathecal injection, and then cerebral vascular imaging is achieved. According to the rare earth nano fluorescent material, NaErF4: x% Ce serves as a fluorescence emission core, NaYF4: y% Yb serves as a fluorescence emission middle layer, NaYF4 serves as a fluorescence emission shell layer, through Er < 3 + > ion self-sensitization, under 808 nm excitation, an NIR-II region fluorescence emission peak of 1525 nm is achieved, NaYF4 serves as an inert shell layer, the luminous intensity of the fluorescent material is further improved, and NIR-II region high-resolution fluorescence imaging of mouse cerebral vessels is achieved in combination with intrathecal injection.

The inventor has synthesized 2 '-O > 2-methoxyethyl modified FXYD2-LASO (FXYD2-LASO-gapmer) and injects the 2'-O > 2-methoxyethyl modified FXYD2-LASO and the 2 '-O > 2-methoxyethyl modified FXYD2-LASO-gapmer into the vein, and an application way with relatively small invasiveness is provided. Intravenous administration of the FXYD2 optimized antisense oligonucleotide (LASO) with MOE, compared to intrathecal administration, allows for a long-term effect on pain. The inventors have proven this long term effect on neuropathic pain in spinal nerve ligation (SNL) rat models and inflammatory pain in complete Freund's adjuvant (CFA) induced rat models. Thus, the present invention relates to antisense oligonucleotides targeting FXYD2 for use in the treatment of pain wherein the antisense oligonucleotides are administered intravenously.

The present application relates to TAT-PO1 and its application in treating amyotrophic lateral sclerosis (ALS). The polypeptide connects TAT sequence (SEQ ID NO. 1) and PO1 sequence (SEQ ID NO. 2) through amino hexanoic acid (AHX), and its amino acid sequence is YGRKKRRQRRR{AHX}RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. TAT-PO1 can competitively block the interaction between PGAM5 and OMA1, thereby interfering with the pathological mechanism of ALS. The polypeptide TAT-PO1 of the present application can be prepared into a drug, and directly targets the central nervous system through intrathecal injection or intravenous administration, thereby providing a new strategy for the treatment of ALS. In addition, the design idea can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, thereby providing a technical paradigm for the development of related drugs.

A therapeutic composition is provided which comprises at least one agent which specifically interferes with PTBP2-binding in the SYNGAP1 gene region to prevent dysfunctional protein production caused by an alternative splicing event, which dysfunctional protein is associated with a disease or disorder. The agent can be an anti-sense oligonucleotide, an RNAi, or combinations thereof. The composition may further comprise a pharmaceutically acceptable aqueous diluent suitable for intrathecal injection. Also provided are methods of treating SYNGAP1-related neurodegenerative disorders.

Determining a patency level for an intrathecal access site includes receiving a complex cerebrospinal fluid (CSF) pressure signal for an intrathecal access site, processing the complex CSF pressure signal to extract a heart rate component and a respiratory rate component, processing the heart rate component and the respiratory rate component to determine a patency level for the intrathecal access site. An indication of the patency level may be output in any of various forms such as to automatically control a pump or other device or to provide informational input to a medical provider.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.