74 results about "Intrathecal use" patented technology

The invention provides a ziconotide nasal-brain delivery preparation which is high in brain targeting, safe and noninvasive and directly enters the brain through nasal administration. The nasal-brain delivery preparation comprises an active component ziconotide and an absorption enhancer, wherein the absorption enhancer is selected from one or more of dodecyl-beta-D-maltoside (DDM), menthol, hydroxypropyl-beta-cyclodextrin (HP-beta-CD), sodium glycocholate (SGC) and related derivatives thereof. The absorption enhancer with a specific type and content and the ziconotide cooperate and act together, so that the ziconotide bypasses a blood brain barrier, enters the brain through a nasal olfactory mucous membrane, forms a medicine storage bank in an olfactory bulb, is slowly released to the brain and keeps a long-term medicine effect, and therefore, a traditional ziconotide intrathecal administration mode is abandoned; the ziconotide nasal-brain administration mode is created, and the ziconotide nasal-brain administration method is a new-generation therapy for pain diseases related to the central nervous system.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The invention provides application of PRP-Exos in preparation of a medicine for treating neuropathic pain, and relates to the technical field of clinical medicine. According to the invention, the treatment effect of PRP-Exos on neuropathic pain by inhibiting a TLR4 / NF-kappa B signal channel is clarified, a new thought is provided for clinical transformation, meanwhile, an intrathecal injection delivery mode is adopted, the limitation of low bioavailability of peripheral administration is overcome, meanwhile, the treatment effect is comprehensively verified through a behavioral-histological-molecular biological multi-modal evaluation system, and the application prospect is wide. The potential of the PRP-Exos in relieving the neuropathic pain is proved.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The utility model discloses a real-time positioning system for implanting a catheter in a potential guiding sheath. The real-time positioning system comprises a positioning electrode plate, a potential guiding instrument and a guide wire body, the positioning electrode plate comprises an adhesive tape adhered to the body of a patient and a plurality of electrode plates arranged on the adhesive tape; the potential guiding instrument comprises a shell, positive and negative electrodes, a current change display and a voltage and current regulator are arranged on the shell, and a current signal receiver and a signal amplifier are arranged in the shell; the guide wire body comprises an insulating sleeve and a metal guide wire arranged in the insulating sleeve, the front end and the rear end of the insulating sleeve are closed, and a plurality of through holes are formed in the side wall; the head end of the metal guide wire is exposed, and the other part is wrapped by the insulating layer. The positioning electrode plate and the wire guide body are respectively connected with positive and negative electrodes to form a closed loop. The intrathecal infusion system solves the problems that in the implantation operation process of the intrathecal infusion system, the position of the catheter needs to be adjusted in a perspective mode repeatedly, real-time monitoring cannot be achieved, and the developing quality is not high, operation precision and efficiency are improved, and the X-ray exposure amount of a patient is reduced.

Abstract A blood pump assembly includes an introducer sheath with a proximal end and a distal end, a pump body which extends within the introducer sheath, and a catheter that interfaces with the pump body and extends proximally though the introducer sheath. In a rest state, the introducer sheath forms an oval cross-section sized to encompass the catheter and a medical device. In a constrained state when the pump body is within the introducer sheath, the cross- section of the introducer sheath is circular. The malleability of the introducer sheath allows larger medical devices to be passed through the introducer sheath, while still allowing other devices to be inserted through the introducer sheath after the pump has been guided through. A perimeter of oval cross­section of the introducer sheath is equal to the perimeter of the circular cross-section of the introducer sheath. Abstract circular cross-section of the introducer sheath. 20 26 20 47 20 18 J un 2 02 6 A b s t r a c t 2 0 2 6 2 0 4 7 2 0 1 8 J u n 2 0 2 6

The present disclosure provides a double-stranded siRNA with lipophilic modification. The modified siRNA molecules exhibit excellent in vivo distribution and delivery efficiency via intrathecal injection, intradermal injection, or other administration routes. The molecules effectively knock down target gene expression while maintaining good tolerability and safety. The present disclosure further provides a preparation method of siRNA with lipophilical modification, a pharmaceutical composition, and application of the same in the preparation of a medicament for treating a TNF-α-mediated disease or disorder.

This allows for the insertion of multiple medical devices into the patient's vascular system via a single access point through an introducer sheath. [Solution] The intravascular system includes an introducer sheath 104 having a lumen of fixed diameter, a first medical device 102, and a catheter 106 having a proximal end and a distal end coupled to the first medical device. When the catheter is placed within the introducer sheath, an annular gap is formed between the outer circumference of the catheter and the inner circumference of the lumen. The catheter is configured to take on different dimensional forms such that the size of the catheter and the annular gap are variable.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

Systems, methods, and devices are disclosed for administering a therapeutic agent to a patient and improving therapeutic effects of such agents on a patient. A stimulation is applied to a portion of a patient's spine, and the therapeutic agent is administered to the patient intrathecally and proximal to the portion of the patient's spine. In some embodiments, a second stimulation is applied to the patient at a second portion of the patient's spine and concurrently with administering the therapeutic agent. Concerted stimulation of the patient's spine administering a therapeutic agent synergistically improves treatment outcome.

The invention discloses a lipophilic modified nucleic acid medicine composition and application thereof, the lipophilic modification is saturated or unsaturated C4-C30 alkyl, the composition comprises an absorption enhancer, and the method is that the lipophilic modified nucleic acid medicine is delivered to the brain through the nasal mucosa. Nucleic acid drugs are transmitted into the olfactory bulb region through a neural pathway, namely, cross-olfactory mucosa, bypass BBB and directly enter the brain, the drug concentration content of the olfactory bulb is far higher than that of other tissues of the brain, and the tissues except the olfactory bulb are uniformly distributed, so that the olfactory bulb can be used as a drug reservoir and gradually and slowly spread to the other tissues of the brain; the long-time drug effect can be maintained by one-time drug administration, so that the drug administration frequency can be reduced. Compared with intrathecal injection, by adopting the composition disclosed by the invention for nasal administration and using 1 / 2 of intrathecal administration dosage, the same intrathecal steady-state distribution as intrathecal distribution can be achieved, so that the method disclosed by the invention is safer, noninvasive and efficient.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The application discloses application of an inhibitor targeting CCL28 in treatment of visceral pain. The application firstly proves that CCL28 is significantly up-regulated in spinal cord dorsal horn neurons of a mouse model of visceral pain, and establishes CCL28 as a new target for treatment of visceral pain. On this basis, the application designs and screens a high-efficiency and specific siRNA sequence targeting CCL28, the siRNA can be delivered to the spinal cord locally through intrathecal injection, specifically silences CCL28 gene expression, inhibits activation of a downstream ERK signal pathway, thereby significantly alleviating visceral pain, and has no obvious off-target effect. The application provides a complete technical scheme from target discovery to drug intervention, provides a new strategy and a drug candidate molecule for treatment of visceral pain, and has a good clinical application prospect.

The present application relates to TAT-PO1 and its application in treating amyotrophic lateral sclerosis (ALS). The polypeptide connects TAT sequence (SEQ ID NO. 1) and PO1 sequence (SEQ ID NO. 2) through amino hexanoic acid (AHX), and its amino acid sequence is YGRKKRRQRRR{AHX}RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. TAT-PO1 can competitively block the interaction between PGAM5 and OMA1, thereby interfering with the pathological mechanism of ALS. The polypeptide TAT-PO1 of the present application can be prepared into a drug, and directly targets the central nervous system through intrathecal injection or intravenous administration, thereby providing a new strategy for the treatment of ALS. In addition, the design idea can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, thereby providing a technical paradigm for the development of related drugs.

Determining a patency level for an intrathecal access site includes receiving a complex cerebrospinal fluid (CSF) pressure signal for an intrathecal access site, processing the complex CSF pressure signal to extract a heart rate component and a respiratory rate component, processing the heart rate component and the respiratory rate component to determine a patency level for the intrathecal access site. An indication of the patency level may be output in any of various forms such as to automatically control a pump or other device or to provide informational input to a medical provider.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The invention provides an application of an exosome in preparation of a medicine for treating syringomyelia. The MSCs-sourced exosome is used for treating syringomyelitis for the first time, and the MSCs-sourced exosome is low in immunogenicity, high in safety and more stable. Therefore, the traditional Chinese medicine composition is easily accepted by patients and is low in cost. And secondly, the exosome is small in size, so that the exosome is conveyed in an intrathecal injection manner, and is not easy to block. Many researches show that the exosome from the MSCs has the effects of protecting nerves and regulating immune microenvironment, can play the same curative effect as the MSCs, has no proliferation ability, no tumorigenicity or immunological rejection risk, and has higher safety than the direct transplantation of the MSCs, so that the exosome better meets the requirements of clinical transformation ethics. Intrathecal exosome injection is expected to become an ideal administration way for treatment of spinal cord diseases such as syringomyelia.

The present invention relates to an adeno-associated virus (AAV) vector optimized for intrathecal administration into which a hepatocyte growth factor gene is introduced. The AAV vector of the present invention and AAV particles produced through the vector have excellent productivity of AAV particles comprising a hepatocyte growth factor gene, and when administered intrathecally to a mammal, the expression efficiency of hepatocyte growth factor is also very high. Therefore, the AAV vector of the present invention and the AAV particles induce the expression of hepatocyte growth factor protein when administered intrathecally, and thus can be effectively used in the prevention or treatment of related diseases.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The present invention is directed to methods for treating or preventing neuroinflammation in a subject by administering an effective amount of a single-domain antibody (sdAb) comprising SEQ ID NO:1. The method is applicable to subjects with multiple sclerosis, including secondary progressive, primary progressive, and relapsing-remitting forms. Administration may be intravenous, subcutaneous, or intrathecal, with dosage regimens including daily administration, loading and maintenance doses, or continuous infusion. The method may be initiated upon first clinical signs of central nervous system demyelination and contin- ued for at least 14 days. The sdAb may be co-administered with a pharmaceutically acceptable excipient such as mannitol, sucrose, or polysorbate 80, and optionally combined with disease-modifying therapies including interferon-β, glatiramer acetate, fingolimod, or ocrelizumab. The invention provides a targeted approach for modulating neuroinflammatory processes in neurological disorders.

A medical retractor avoids medical staff continuously operating the medical retractor with hands, greatly liberates the hands of medical staff, reduces labor cost, and can expand a surgical space, more clearly expose a surgical visual field, and be beneficial to a doctor to perform more accurate surgical operation and shorten a surgical time. The medical retractor comprises a clip fixed end (1), a linking sheath (2), a nut position fixed lock (3), a movable rod (4), and a first clip movable end (5). The first clip movable end is connected with an anterior sheath of a rectus abdominis muscle. One end of the movable rod is connected with the clip fixed end. The body of the linking sheath is a hollow rod. The movable rod is inserted into the body of the linking sheath. The movable rod is fixed in the linking sheath by screwing the nut position fixed lock. One side of the clip fixed end is fixed at the top end of the linking sheath, and the other side clamps a fixed object.

The application discloses application of human amniotic epithelial stem cells in preparation of a medicine for treating depressive diseases. The human amniotic epithelial stem cells are obtained by mechanically separating the inner surface amnion of discarded placental tissue, and then subjected to trypsin digestion, centrifugation, resuspension and harvesting in sequence after washing; and a human amniotic epithelial stem cell scheme for treating depression; the cells are widely sourced, free of ethical controversy, low in immunogenicity and non-tumorigenic, and provide a new safe and effective approach for treating depression; the cell preparation can be administered through intravenous injection, intrathecal injection or nasal delivery, and the mechanism of action is to inhibit the overactivation of glial cells, reduce the depressive-related neuroinflammatory response, and thus improve the neuronal microenvironment. The application can effectively promote hippocampal neurogenesis (increase in DCX positive cells), regulate 5-hydroxytryptaminergic neurons and glutamatergic neuron activity, restore the steady state of neural networks, and significantly improve the depressive behavior of model mice.

A sheath assembly for introducing a catheter pump into a body of a subject is disclosed, comprising a first sheath and a second sheath, the first sheath comprising a second section. In the process of moving the pump assembly from the first sheath to the second sheath, a position suitable for exhausting the pump assembly exists: the second section hermetically wraps the outer wall of the pump assembly, the third opening is located in the second sheath, and the first opening is located in the first sheath; the closed second section clamps and seals the outer wall of the pump assembly, and a unique channel through which blood can only flow from the third opening to the pump assembly to the first opening is established; and the first opening is located at the distal end of the first resealable member such that blood flowing out of the first opening is trapped within the first sheath by the first resealable member.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The invention relates to TAT-PO1 and application of TAT-PO1 in treatment of neurodegenerative disease amyotrophic lateral sclerosis. The polypeptide is connected with a TAT sequence (SEQ ID NO.1) and a PO1 sequence (SEQ ID NO.2) through aminocaproic acid (AHX), and the amino acid sequence of the polypeptide is as follows: YGRKKRRQRRR {AHX} RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. The TAT-PO1 can competitively block the interaction between the PGAM5 and the OMA1, so that the pathological mechanism of the ALS is intervened. The polypeptide TAT-PO1 disclosed by the invention can be prepared into a medicine, and directly targets a central nervous system through intrathecal injection or intravenous administration, so that a new strategy is provided for ALS treatment. In addition, the design thought can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, and a technical normal form is provided for development of related drugs.

This disclosure provides mixtures of beta-cyclodextrin molecules substituted at one or more hydroxyl positions by hydroxypropyl groups, the mixture optionally including unsubstituted beta-cyclodextrin molecules, for use as a pharmaceutically active ingredient; methods of making such mixtures; methods of qualifying such mixtures for use in a pharmaceutical composition suitable for intrathecal or intracerebroventricular administration; pharmaceutical compositions suitable for intrathecal or intracerebroventricular administration comprising such mixtures; and methods of using the pharmaceutical compositions for treatment of Niemann-Pick disease Type C.

The present invention is directed to methods for treating or preventing neuroinflammation in a subject by administering an effective amount of a single-domain antibody (sdAb) comprising SEQ ID NO:1. The method is applicable to subjects with multiple sclerosis, including secondary progressive, primary progressive, and relapsing-remitting forms. Administration may be intravenous, subcutaneous, or intrathecal, with dosage regimens including daily administration, loading and maintenance doses, or continuous infusion. The method may be initiated upon first clinical signs of central nervous system demyelination and continued for at least 14 days. The sdAb may be co-administered with a pharmaceutically acceptable excipient such as mannitol, sucrose, or polysorbate 80, and optionally combined with disease-modifying therapies including interferon-β, glatiramer acetate, fingolimod, or ocrelizumab. The invention provides a targeted approach for modulating neuroinflammatory processes in neurological disorders.