Patents
Literature
Patsnap Copilot is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Patsnap Copilot

36 results about "Long QT syndrome" patented technology

Heart rhythm disorder that can cause fast, chaotic heartbeats.

Method for screening hERG potassium ion channel agonist and detecting toxicity

The invention relates to a method for screening hERG potassium ion channel agonist and detecting toxicity. Particularly, the invention firstly relates to a fusion protein, which contains a fragment (which is used as the N end of the fusion protein, is from a position between 1st to 85th amino acid residues of the N end of the nemathelminth ERG family potassium ion channels UNC-103 protein and has the length of 75 to 85 amino acid residues), hERG or a fragment at least containing S1-S6 transmembrane domains and cyclic nucleotide binding domains, and a fragment (which is used as the C end of the fusion protein, is from a position between 590th to 829th of amino acid residues of the C end of the UNC-103 protein and has the length of 220 to 240 amino acid residues). The invention also relates to a polynucleotide sequence coding the fusion protein, a relevant transgenic nemathelminth, a relevant screening method and application. The inventor builds an in-vivo hERG-intracellular-transport-influence-recognizable compound molecule screening method for screening hERG inhibitors or LQTS (long QT syndrome) relevant channel mutant functional correcting agents for the first time; the novel path and method are provided for hERG toxicity detection and LQTS treatment medicine screening.
Owner:CENT FOR EXCELLENCE IN BRAIN SCI & INTELLIGENCE TECH CHINESE ACAD OF SCI

Polypeptide for constructing long QT syndrome animal model

ActiveCN111892660AQT prolongationSimple and reliable method of establishmentPolypeptide with localisation/targeting motifCalcium binding proteinsPhysiologyGuinea pig
The invention belongs to the field of animal experiment modeling methods, and relates to a polypeptide for constructing a long QT syndrome animal model and a method for establishing an animal model for an animal experiment. According to the polypeptide for constructing the long QT syndrome animal model, an amino acid sequence of the polypeptide is GRKKRRQRRRGEVDEMIREADIDGDGQVNYEGFVQMM, and the polypeptide is named as CM4. The method for establishing the long QT syndrome animal model comprises the step of administering the polypeptide CM4 to an animal to obtain the long QT syndrome animal model. The model establishing method provided by the invention is simple and reliable, and is convenient for researchers to establish a long QT syndrome mouse or guinea pig isolated heart model and carry out related experimental researches. The modeling process is simple and effective, meanwhile, a corresponding control group can be set, and electrocardiogram changes before and after amino acid mutation are compared and analyzed. The CM4 is given to induce the QT interval of isolated hearts of mice and guinea pigs to be prolonged, the CM4 is easy to obtain and high in purity, the CM4 can penetratethrough cell membranes to enter cells to play a role, the activity of myocardial calcium channels is adjusted, the molding efficiency is high, the cost is low, and research of related experiments is facilitated.
Owner:中国医科大学
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products