33 results about "Citrus plant" patented technology

The utility model discloses a citrus is planted and is used fertilizer mixing device, including mixing shell, the opening of mixing shell top movable cover has top cover, the rotatory setting of mixing shell is in the central shaft, the movable insertion of several stirring rods has in the central shaft. The utility model discloses through the mutual cooperation of mixing shell, top cover, central shaft, stirring rod, auxiliary rod, feeding port, discharge cover, drive plate, hydraulic cylinder no.

A seedling transplanting fixed-distance auxiliary device for citrus planting relates to the technical field of citrus planting and comprises a shell which is of a rectangular block structure with a hollow interior; the planting assemblies are linearly arranged at intervals in the length direction of the shell, each planting assembly freely penetrates through the shell in the direction perpendicular to the length direction of the shell and is slidably connected with the shell, each planting assembly is provided with two planting positions, and the two planting positions are located on the two sides of the shell respectively; the adjusting assembly comprises an operation part rotationally arranged at one end of the shell, a transmission part rotationally arranged in the shell in the length direction of the shell and a telescopic part arranged in the shell, the power input end of the transmission part freely penetrates out of the shell and then is connected with the operation part, and the power output end of the transmission part is connected with the telescopic part; the telescopic end of the telescopic piece is connected with the plurality of planting assemblies; the operation part is rotated to drive the telescopic end of the telescopic part to move through the transmission part so as to change the distance between the planting assemblies.

The application discloses a method for improving the resistance of citrus to Huangyanbing by using ClPsaN gene, comprising the following steps: (1) cloning a VIGS fragment of the citrus ClPsaN gene; (2) constructing two VIGS expression vectors of TRV and CLBV; and (3) transforming the VIGS expression vector into citrus to obtain VIGS plants in which the citrus ClPsaN gene is silenced. According to the method, the VIGS vector of the citrus ClPsaN gene is constructed, then the vector is transformed into citrus, and the obtained citrus plants can obviously show resistance to Huangyanbing. The titer of Huangyanbing, i.e., Huangyanbing yellow vein-illness virus, can be reduced by 22-34%, and the accumulation amount of virus protein can be reduced by 35-50%, so that the incidence of Huangyanbing is significantly reduced. In addition, the TRV silencing of the citrus ClPsaN gene does not affect the phenotype of the citrus plants, and the citrus ClPsaN gene can be used as a candidate gene to be used in the breeding of citrus plants resistant to Huangyanbing by using VIGS silencing, RNA interference and gene editing technologies in cooperation with multiple genes of the citrus plants resistant to or susceptible to Huangyanbing.

The utility model relates to the technical field of insect prevention devices, and discloses an insect prevention device for a citrus planting greenhouse, which comprises an outer shell and an insect prevention box, the upper end of the outer shell is fixedly provided with a fixed column, the lower end of the outer shell is movably provided with a material conveying port, one end of the material conveying port is movably connected with an insect killing box, and the other end of the material conveying port is movably connected with a water pump. A flame projector is fixedly installed on one side of the inner wall of the deinsectization box, a material conveying opening is movably sleeved with a hose, the other end of the hose is movably sleeved with a connecting pipe, the lower end of the connecting pipe is movably connected with a two-way air suction pump, and a sliding way is formed in a groove in the lower end of the outer shell. The sliding head and the sliding way are used in cooperation, the sliding head can be driven to move on the sliding way by means of free movement of the sliding wheel of the sliding head on the sliding way, the sliding head is fixedly connected with the insect prevention box through the connecting rod, the insect prevention box can move within a certain range below the outer shell, the insect killing range can be widened, and therefore the insect killing rate of the device is improved.

The application provides a method for improving the resistance of citrus to canker disease based on gene interference, which comprises the following steps: introducing a long-chain fatty alcohol oxidase gene in a citrus plant into an interference vector as an interference sequence, and integrating the interference sequence into the citrus genome by means of agrobacterium-mediated genetic transformation, so as to effectively improve the resistance of the citrus to canker disease. CsFAO3 The part of the coding sequence of the gene, i.e., the sequence as shown in SEQ ID NO: 3, is used as an interference sequence, introduced into an interference vector, and integrated into the citrus genome by means of agrobacterium-mediated genetic transformation, so as to effectively improve the resistance of the citrus to canker disease. The method can directly inhibit most of the pathogenic bacteria causing the canker disease of the citrus, the gene to be interfered with can greatly improve the resistance of the citrus to the canker disease while reducing the adverse effects on the known quality and performance of the citrus to the greatest extent, a new way for the breeding of the citrus resistant to the canker disease is opened up, and the development of the breeding of the citrus resistant to the canker disease is promoted.

This invention discloses a butterfly adult directional attractant based on volatile chemical substances, along with its preparation and application methods. The invention uses a combination of readily available chemical reagents, such as linalool, as volatile signaling substances to efficiently induce various butterfly adults, including the Common Mormon and the Citrus Swallowtail, which use citrus plants (Rutaceae family) as hosts, to complete forward directional movements through flight or walking. This method can induce the synchronized directional movements of multiple butterflies of various species at a relatively low cost, and has significant practical value for human-butterfly interaction projects in ecological landscape construction and recreational experience settings.

The invention discloses a nerve calming and sleep promoting incense, which has treatment and health care potential, and citrus plants such as citrus, bergamot, grapefruit and the like are considered to have soothing and relaxing effects; plants such as pepper, geranium and lavender are considered to have the characteristics of calming and promoting sleep; pogostemon cablin, cedar, vetiver grass and other plants may help relieve anxiety and pressure.

The invention relates to the technical field of plant squeezing, and discloses plant squeezing equipment for essence refining, which comprises a support and a screen drum rotatably arranged on the support, and a feeding auger for extracting citrus plant essence, a driving part and a cleaning part arranged on the support are arranged in the screen drum. A plurality of through holes are formed in the circumferential outer wall of the screen drum, frustums are irregularly arranged on the circumferential inner wall of the screen drum, the feeding auger is divided into a shaft rod and spiral blades, the diameter of the shaft rod is gradually increased from front to back, a cavity is formed in the shaft rod, and a puncturing piece is arranged in the cavity. The plant squeezing equipment for essence refining can effectively solve the problems that in the prior art, due to the fact that the squeezing equipment completely stops working in the residue removing period, the production takt is obviously stopped, the smoothness of the whole squeezing process is directly damaged due to a discontinuous working mode, and the production efficiency is greatly improved. The problems of low equipment output efficiency and unstable essential oil extraction are further caused.

The application discloses a primer and a method for identifying whether citrus fruits have low-temperature color promoting potential. CitHB7 After the specific primer designed for the promoter is used for PCR amplification reaction on the DNA of the citrus plant, whether the fruit has the low-temperature color promoting potential after harvesting is judged according to the target band after amplification. The citrus plant with the 750 bp target band has the low-temperature color promoting potential after harvesting; the citrus plant with the 100 bp target band does not have the low-temperature color promoting potential. The method provided by the application can quickly identify whether the citrus fruit has the low-temperature color promoting potential, and provides guarantee for accurate application of the low-temperature color promoting technology in postharvest treatment of the citrus fruit.

This invention discloses a method for enhancing the high-temperature resistance of citrus through exogenous spraying of naringin, belonging to the field of agricultural technology. The method involves preparing naringin into a formulation and spraying it exogenously onto the leaves of citrus plants. Experiments show that after treatment with naringin, phenotypic damage such as wilting and curling of citrus seedling leaves under high-temperature stress is significantly alleviated; the maximum photochemical efficiency of photosystem II (Fv / Fm) is significantly increased; electrolyte leakage rate and malondialdehyde content are significantly reduced; and the accumulation of hydrogen peroxide and superoxide anions is effectively inhibited. This invention utilizes naturally sourced naringin to significantly enhance the tolerance of citrus to high-temperature stress through multiple mechanisms, including maintaining photosynthetic system function, protecting cell membrane integrity, inhibiting membrane lipid peroxidation, and scavenging reactive oxygen species. Furthermore, the method is simple to operate, environmentally friendly, and low-cost, making it suitable for stress-resistant citrus cultivation.

The application discloses a kind of citrus psylla intelligent detection method and device based on deep learning, method includes the following steps: S1, acquisition citrus psylla color image under natural orchard scene, pre-treatment is carried out to acquisition image, and citrus psylla dataset is made;S2, improvement YOLOv5-s network model, using citrus psylla dataset is iteratively trained to improved YOLOv5-s network model, and optimal model is obtained and used as psyllid detection model;S3, using 2 pairs of servo steering engine is formed rotatable holder and carries variable zoom camera and forms image collector;Psyllid detection model is deployed to embedded device, and using the equipment control image collector;S4, the image obtained by image collector is input into psyllid detection model and is identified, determines whether there is citrus psylla in the image photographed and its position.The method and device of the application can be deployed in natural orchard, and the citrus plants in a certain distance range are efficiently and intelligently monitored to determine whether there is citrus psylla.

The present disclosure relates generally to methods and systems for controlling Candidatus Liberobacter Disease in citrus plants, including, for example, orange trees. In some embodiments, the methods comprise injecting an injection formulation comprising a combination of oxytetracycline and streptomycin into a tree.

The utility model relates to citrus planting technical field, specifically disclose a kind of citrus orchard using organic fertilizer and soil loosening device for applying, including support chassis, its upper surface is fixedly connected with fertilizer storage barrel, the upper surface of fertilizer storage barrel is installed with feed opening, the upper surface of support chassis is fixedly connected with feeding pump, the surface of feeding pump is installed with guide pipe, the lower end of guide pipe is through support chassis surface, and the lower end of guide pipe is fixedly connected with fertilization connecting frame, and the first linkage wheel is installed in support chassis lower end.This citrus orchard uses organic fertilizer and soil loosening device for applying, realizes soil loosening and fertilization synchronous, solve the problem that traditional device needs step-by-step operation, when soil turning mechanism is driven soil turning connecting wheel soil turning, fertilization connecting frame can synchronous drop fertilizer, make fertilizer directly and loose soil fully mix, improve operation efficiency and fertilizer absorption effect.

The utility model relates to the technical field of citrus planting pit digging devices, and discloses a planting pit digging device which comprises a machine box, a baffle and a pit digging structure, a first motor and a second motor are fixedly arranged at the front position of the upper end of the machine box, a fixing sleeve block is hinged to the upper side of the baffle, and a torsion spring is arranged at the hinged position of the fixing sleeve block and the baffle. A first inner groove is formed in the position, close to one side, of the interior of the baffle, a first spring is fixedly arranged on the inner wall of one side of the first inner groove, a first fixing plate is fixedly arranged at one end of the first spring, and an inserting block is fixedly arranged at one end of the first fixing plate; and a sleeve rod is rotationally arranged at the front part in the connecting plate. According to the device, the pit digging structure is arranged, so that soil can be conveniently dug, the cover body is arranged to prevent the soil from collapsing into the pit, a nutrient solution can be immediately added into the pit after the pit digging, and the device is convenient to use.

This invention discloses the application of spearmint oil and spearmint oil-containing compositions in the control of citrus Huanglongbing (HLB), belonging to the field of agricultural disease control. This invention provides the application of spearmint oil in inhibiting the pathogen of citrus HLB. Addressing the problem of the lack of effective green control methods for citrus HLB, this invention screened a fungicide of the pathogen of citrus HLB from a natural plant-derived active substance. Spearmint oil not only has a significant direct inhibitory and killing effect on the pathogen of citrus HLB, but also induces systemic resistance in citrus plants and enhances tree vigor. The spearmint oil of this invention is derived from natural plants, has clearly defined main components, is biodegradable in the environment, has extremely low residue risk, and meets the requirements of green agriculture and safe agricultural production.

The application discloses application of a citrus CgABR gene in regulating fruit base length of a grapefruit. The application proves for the first time that the CgABR gene negatively regulates the fruit base length of the grapefruit. The application further takes tomatoes as a model to prove through experiments that, compared with the fruit base length of a wild type plant, the fruit base length of a T2 generation positive plant fruit overexpressing the CgABR is significantly shortened, which lays a foundation for improving citrus plants, especially grapefruit plants, in fruit shape by using genetic engineering and provides a new gene resource.

The invention discloses a method for improving canker resistance of citrus by using a CsFKBP16-4 gene, and relates to the field of molecular biology, the transcriptional level of the FKBP16-4 gene in citrus plants is reduced by interfering RNA, and the nucleotide sequence of the interfering RNA is as shown in SEQ ID NO: 1. A part of coding sequence of the CsFKBP16-4 gene is used as an interference sequence, is introduced into an interference vector, and is integrated into a citrus genome through an agrobacterium-mediated genetic transformation method, so that the canker resistance of citrus is effectively improved. The canker attack degree of the obtained transgenic plant can be reduced to 28.3% of that of the existing citrus, the canker symptom of the transgenic citrus is remarkably relieved, and the canker resistance of the citrus is improved. In addition, transgenic citrus plants can directly inhibit proliferation of pathogenic bacteria causing canker, the canker can be ensured to be inhibited essentially, another way for citrus canker-resistant breeding is opened up, and development of citrus canker-resistant breeding is promoted.

The present application relates to the technical field of citrus cultivation, and particularly relates to application of a green transition peptide in relieving iron deficiency chlorosis of citrus leaves, and application of the green transition peptide in a product for relieving iron deficiency chlorosis of citrus leaves. An amino acid sequence of the green transition peptide is NTLISKVLNKGDAFVFPIGLIHFQFNIGK. The green transition peptide is applied to promote absorption and transport of iron elements by citrus plants, the green transition peptide and EDDHA-iron can play a synergistic effect, relieve iron deficiency chlorosis of citrus, increase iron content and chlorophyll content of leaves, improve photosynthetic rate, increase fruit content, and improve fruit quality.

The present invention provides a cosmetic composition comprising: a first component comprising a tyrosinase inhibitor; a second component comprising an extract of a Citrus plant; and a nonionic lipid. The invention also provides a method for preparing the cosmetic composition. The invention further provides application of the cosmetic composition in preparation of cosmetics for inhibiting skin melanin.

The invention discloses an application of an antibacterial peptide Hinnavin I in improvement of citrus liberobacter asiaticum resistance, and relates to the technical field of forest breeding, and the application comprises the following steps: introducing a nucleotide sequence for coding the antibacterial peptide Hinnavin I into a citrus plant through a genetic transformation method, and expressing the antibacterial peptide Hinnavin I in the citrus plant to inhibit proliferation of citrus liberobacter asiaticum pathogenic bacteria. According to the invention, the animal-derived antibacterial peptide can be expressed in a transgenic hairy root after a nucleotide sequence for coding Hinnavin I is introduced into a citrus plant; the Hinnavin I inhibits the proliferation of the pathogenic bacteria of the citrus huanglongbing by destroying the membrane structure of the pathogenic bacteria of the citrus huanglongbing, and as the Hinnavin I is an animal-derived peptide, and the expression of the Hinnavin I in plants does not involve chemical pesticides, an environment-friendly and high-targeting green prevention and control means is achieved, and meanwhile, the purpose of cross-species application of animal immune elements in plant disease prevention and control is expanded.

This utility model relates to the technical field of fertilizer mixing devices, and discloses a mixing device for citrus planting fertilization, including a mixing tank. The top of the mixing tank is equipped with an upper protective cover, and a feed inlet is installed on the top right side of the upper protective cover. A guide hopper is installed at the bottom of the upper protective cover. A lower support rod is installed inside the mixing tank, and a rotating shaft is installed at the top of the lower support rod. A stirring mesh box is installed inside the rotating shaft. This utility model, through its separation and mixing structure, allows fertilizer granules to be introduced into the stirring mesh box inside the mixing tank through the feed inlet and guide hopper at the top of the upper protective cover. Water is then supplied to the mixing tank through the liquid inlet. A stirring motor rotates within the lower support rod inside the mixing tank via the rotating shaft, causing the stirring mesh box and the fertilizer granules inside the stirring mesh box to rotate and dissolve into the liquid inside the mixing tank, thus achieving the separation and mixing function.

The utility model discloses an intelligent accurate control fertilization device and agricultural machinery vehicle, relates to fertilization device technical field, including carrier platform, carrier platform close to the front end position is fixedly equipped with the fixed plate, fixed plate upper end is fixedly equipped with the cross bar, the cross bar upper end is rotatingly connected with the rotary rod, the rotary rod is fixed on the fixed plate. A disc gear is fixedly connected to the outer wall of the rotating rod, a stand column is fixedly connected to the upper end of the cross rod, a second motor is fixedly installed at the upper end of the stand column, a bevel gear is fixedly connected to the output end of the second motor through a guide rod, and the bevel gear is meshed with the disc gear. The carrier platform and the motor are in signal connection with an external remote controller; the working state of the pump body can be controlled through an external remote controller, the spraying amount of the fertilizer can be accurately adjusted, the second motor drives the spraying head to swing back and forth, the spraying range and angle can be flexibly adjusted according to the actual layout and requirements of citrus planting, accurate coverage is achieved, and the fertilizer fully acts on citrus plants.

The invention belongs to the field of citrus hybridization, and provides an optimization method for shortening the juvenile phase of citrus filial generations under facility cultivation. Comprising the following steps in sequence: parent selection and hybridization, seed synergistic pretreatment, germination and initial environment control, vegetative growth balance regulation and control, chemical induction and physical flower promotion, directional pruning and shaping, and continuous monitoring and feedback regulation. According to the method, a set of complete juvenile phase shortening technical system is formed from parent selection, seed synergistic pretreatment and accurate environment control in the germination period to vegetative growth balance regulation and control, the juvenile phase of citrus plants is shortened to about one year from traditional 4-5 years, the flowering rate reaches 65%, the physiological state of the plants is stable, the breeding time is greatly shortened, and the breeding cost is reduced. Technical support is provided for rapid iteration and commercial popularization of citrus varieties, and the problem of low breeding efficiency is effectively solved.

The utility model relates to the technical field of citrus planting, in particular to a citrus bagging device for citrus planting. Comprising a holding rod, the whole body of the holding rod is arranged to be a rod body of a Y-shaped structure, an annular connecting table is fixedly arranged at the top end of the rod body, pushing motors are fixedly arranged on the two sides of the connecting table, connecting strips sliding relative to the connecting table are arranged at the output ends of the pushing motors, and an electric heating bin is fixedly arranged on the inner side of each connecting strip; a heating motor is fixedly arranged in the electric heating bin, and the heating motor is electrically connected with two electric heating columns fixed to the inner side of the connecting strip. The technical problems that according to a traditional mode, citrus bagging efficiency is poor, and the process is tedious when fruits at high positions are bagged are solved.

The invention relates to the field of fiber manufacturing, and particularly discloses a natural additive mainly prepared from plant extracts as well as a preparation method and application of the natural additive. The invention relates to a preparation method of a natural additive mainly containing plant extracts. The preparation method comprises the following steps: S1, extracting a cucurbitaceae plant to obtain a plant extract A; s2, extracting a citrus plant to obtain a plant extract B; s3, blending the plant extract A, the plant extract B, nano calcium oxide, lauryl sodium sulfate, a dispersing agent and water to obtain the natural additive. The product provided by the invention is blended with textile fibers to obtain functional composite fibers, and the textile fibers are polyester fibers or viscose fibers. The finally prepared functional composite fiber can provide a safe and comfortable use feeling for a user, a fabric prepared from the functional composite fiber has a good antibacterial effect and good cooling and moisture absorption capacity, the highest temperature is not higher than 28 DEG C within 5-60 min, and the average temperature is not higher than 26 DEG C within 60 min.

The utility model discloses a fixing device for citrus planting grafting, which comprises a first lantern ring, a second lantern ring which is coaxially distributed with the first lantern ring is arranged above the first lantern ring, the inner wall of the first lantern ring and the inner wall of the second lantern ring are respectively provided with a shielding mechanism, and the two lantern rings are connected through a communicating mechanism which is distributed in a surrounding manner; the shielding mechanism comprises an inflation protection structure and a distance adjusting and pressurizing structure, the inflation protection structure comprises an inflation bag assembly installed on the inner side of the lantern ring and a corresponding air injection pipeline, and the distance adjusting and pressurizing structure comprises an adjustable push plate assembly; the communication mechanism is composed of a telescopic connecting rod and used for adjusting the relative position of the two lantern rings, the fixing device for citrus planting grafting is composed of the first lantern ring, the second lantern ring, the shielding mechanism and the communication mechanism, and the first lantern ring and the second lantern ring are fixed in a lossless mode through the flexible inflation clamping and multi-direction pressure adjusting functions of the shielding mechanism; the multi-dimensional adjusting capability of the communication mechanism is adaptive to different grafting scenes, and the four parts have a synergistic effect to remarkably improve the grafting stability and survival rate.

The present disclosure relates generally to methods and systems for controlling citrus greening disease in citrus plants, including for example orange trees.

The application discloses a method for improving the resistance of citrus to bacterial wilt by using CsFKBP16-4 gene, relates to the field of molecular biology, and reduces the transcription level of FKBP16-4 gene in citrus plants by interfering RNA, wherein the nucleotide sequence of the interfering RNA is shown as SEQ ID NO:1. Part of the coding sequence of the CsFKBP16-4 gene is used as an interfering sequence, is introduced into an interfering vector, is integrated into the citrus genome by an agrobacterium-mediated genetic transformation method, and the resistance of the citrus to bacterial wilt is effectively improved. The disease incidence of the obtained transgenic plant to bacterial wilt can be reduced to 28.3% of the existing citrus, the symptoms of bacterial wilt of the transgenic citrus are significantly reduced, the resistance of the citrus to bacterial wilt is improved. In addition, the transgenic citrus plant can directly inhibit the proliferation of pathogenic bacteria causing bacterial wilt, can ensure that bacterial wilt is essentially inhibited, opens up another way for citrus bacterial wilt resistance breeding, and promotes the development of citrus bacterial wilt resistance breeding.

The invention discloses a citrus branch thorn identity determinant TI3 gene and application thereof, and belongs to the field of plant biotechnology and fruit tree genetic breeding. The nucleotide sequence of the citrus TI3 gene is shown as SEQ ID NO: 1, branch thorns can be effectively converted into normal branches or dormant buds by knocking out or inhibiting the function of the TI3 gene, and therefore citrus plants without thorns or with few thorns are created; and the function of knocking out or inhibiting the TI3 gene has no adverse effect on vegetative growth, reproductive growth and other important agronomic traits of the citrus. The invention provides an application of a citrus TI3 gene. The application comprises an application in reducing the number of citrus branch thorns, an application in cultivating citrus varieties without branch thorns or with few branch thorns and an application in improving citrus tree forms. The method disclosed by the invention has extremely high application value and wide industrialization prospect in citrus breeding.

The invention belongs to the technical field of cosmetic raw material extraction, and particularly relates to a natural cosmetic raw material extraction process. The natural cosmetic raw material extraction process provided by the invention has the beneficial effect that the extraction efficiency of natural flavanone can be improved. The natural cosmetic raw material extraction process comprises the following steps: S1, crushing extraction raw materials, and putting the crushed extraction raw materials into processing equipment; s2, putting the grinding material into processing equipment, mixing the grinding material with the crushed extraction raw material, and grinding; s3, adding an extracting agent into the processing equipment, mixing the extracting agent with the ground powder, and extracting to obtain an extracting solution; s4, solid residues in the extraction liquid are filtered; s5, decolorizing the filtered extract liquor; s6, decompressing, concentrating and freeze-drying the decolored extract liquor to obtain the natural flavanone. The raw materials extracted in the step S1 are one or more of epicarp of citrus plants such as lemon, citrus and fragrant citrus. The abrasive material in the step S2 is silicon dioxide particles with the particle size of 400-500 meshes.