Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

69 results about "Citrus plant" patented technology

A multi-energy complementary system of wind, solar, and storage water pumping and rainwater harvesting for coordinated irrigation.

This invention discloses a wind-solar-storage multi-energy complementary water lifting and rainwater harvesting coordinated irrigation system, relating to the field of intelligent irrigation. The system includes: a power unit, a rainwater harvesting unit, a water lifting unit, sprinkler irrigation equipment, and a drone formation. The drone formation is used to fly carrying the sprinkler heads and water pipes of the sprinkler equipment under the control of the control system, and to adjust the sprinkler head's spray position under the control of the control system, and to maintain a safe distance between the water pipes in the sprinkler equipment and ground obstacles under the control of the control system. This invention can realize intelligent and low-cost irrigation for citrus planting in hillside areas.
Owner:SICHUAN ACADEMY OF AGRICULTURAL MACHINERY SCIENCES

Atomization device of plant protection unmanned aerial vehicle for citrus planting

The atomization device of the plant protection unmanned aerial vehicle for citrus planting comprises a top mounting base and a connecting arm, two through holes are symmetrically formed in the lower portion of the top mounting base, a first fixing hole is formed in the top of the connecting arm, and a connecting rod slidably penetrates through the first fixing hole and the two through holes jointly; through cooperative use of the suction mechanism and the heat dissipation mechanism, rapid heat dissipation of the servo motor is achieved, sucked air enters the bottom shell through a one-way valve, the interior of the bottom shell is pressurized, centrifugal atomization of the atomization mechanism is matched, pressurized atomization and centrifugal atomization are achieved, the atomization effect is good, and the service life of the servo motor is prolonged. The water flow is preliminarily segmented by the first segmentation fin, the second segmentation is performed by the cutting column, and the third segmentation is performed by the second segmentation fin, so that the multi-stage segmentation of the water flow is realized, the atomization effect is further improved, and the coaxial opposite rotation of the first-stage atomization assembly and the second-stage atomization assembly can be realized by the single servo motor.
Owner:GANZHOU CITRUS SCI RES INST +1

Intelligent slow-release nano-pesticide, preparation method thereof and application of intelligent slow-release nano-pesticide in prevention and control of diaphorina citri

The invention discloses an intelligent slow-release nano-pesticide, a preparation method thereof and application of the intelligent slow-release nano-pesticide in prevention and control of diaphorina citri. The preparation method comprises the following steps: adding a thiamethoxam methanol solution into a 2-methylimidazole solution, ultrasonically dispersing, adding a zinc nitrate solution while stirring, continuously stirring for 1 hour at room temperature, centrifuging, washing, and removing thiamethoxam to obtain THX ZIF-8 nanoparticles; the preparation method comprises the following steps: adding THX-coated ZIF-8 nano-particles into a Tris-HCl buffer solution, stirring and dispersing, adding dopamine hydrochloride, stirring, centrifuging and washing at room temperature, repeating for three times, and drying overnight to obtain THX-coated ZIF-8 / PDA solid powder, namely the intelligent slow-release nano-pesticide. The nano pesticide not only can effectively prevent and treat diaphorina citri, but also can provide a new strategy for comprehensive prevention and control of the citrus liberobacter asiaticum by reducing the ROS level in plants, enhancing the immunity of the plants and reducing proliferation of the liberobacter asiaticum in the citrus plants.
Owner:GANNAN NORMAL UNIV

Method for improving citrus canker resistance based on CsKCS2 gene

The invention relates to the technical field of agricultural biological genes, and discloses a method for improving citrus canker resistance based on a CsKCS2 gene, and the citrus canker resistance of citrus plants is improved by adjusting the expression level of the CsKCS2 gene in citrus plants. The method specifically comprises the following steps: (1) cloning a citrus CsKCS2 gene sequence; (2) constructing an overexpression vector; and (3) transforming the overexpression vector into citrus to obtain a transgenic material with an up-regulated CsKCS2 gene expression level. By cloning the coding sequence of the citrus CsKCS2 gene, constructing an overexpression vector and then transforming the citrus, the canker attack degree of the obtained CsKCS2 overexpression transgenic plant can be reduced to 73.3% of that of the existing citrus to the maximum extent, the canker attack degree can be effectively and remarkably reduced, the scab area is reduced, the phenotype of the transgenic plant is not influenced, and the application prospect is broad. The gene has a great application value for canker-resistant breeding of citrus, and can be used as a candidate gene for canker-resistant breeding with a plurality of canker-resistant and susceptible genes.
Owner:GERMPLASM INNOVATION GRAND SCIENCE CENTER OF WESTERN CHINA (CHONGQING) SCIENCE CITY

Fertilizer proportioning and stirring device for citrus planting

The utility model provides a fertilizer proportioning and stirring device for citrus planting, and relates to the technical field of citrus planting, the fertilizer proportioning and stirring device comprises a stirring device main body and a working mechanism, the working mechanism is arranged on one side of a sealing cover, and through the arrangement of the working mechanism, when a stirrer needs to be cleaned, a handle is shifted upwards, and the stirring device is started; when the stirrer is used, the handle moves upwards through the first rotating shaft and the second rotating shaft, meanwhile, the first hasp arm moves downwards through the second rotating shaft and extrudes the spring, the spring generates elastic force after being pressed, then the second hasp arm is driven to move upwards, the clamping roller is separated from the clamping base, and therefore the stirrer can be taken down from the connecting base to be cleaned. After cleaning is completed, the clamping roller is moved to the position above the clamping base according to the method, at the moment, the handle is loosened, the spring releases potential energy to push the first hasp arm back to the original position, the second hasp arm also resets, and therefore the clamping roller is tightly clamped into the clamping base, the stirrer is convenient to disassemble, and the service life of the stirrer is prolonged.
Owner:HUANING HUIFENG AGRI DEV CO LTD

A citrus planting fertilizer mixing device

The utility model discloses a citrus is planted and is used fertilizer mixing device, including mixing shell, the opening of mixing shell top movable cover has top cover, the rotatory setting of mixing shell is in the central shaft, the movable insertion of several stirring rods has in the central shaft. The utility model discloses through the mutual cooperation of mixing shell, top cover, central shaft, stirring rod, auxiliary rod, feeding port, discharge cover, drive plate, hydraulic cylinder no.
Owner:YONGCHUN XUGANYUAN FRUIT IND CO LTD

Citrus planting seedling transplanting fixed-distance auxiliary device

A seedling transplanting fixed-distance auxiliary device for citrus planting relates to the technical field of citrus planting and comprises a shell which is of a rectangular block structure with a hollow interior; the planting assemblies are linearly arranged at intervals in the length direction of the shell, each planting assembly freely penetrates through the shell in the direction perpendicular to the length direction of the shell and is slidably connected with the shell, each planting assembly is provided with two planting positions, and the two planting positions are located on the two sides of the shell respectively; the adjusting assembly comprises an operation part rotationally arranged at one end of the shell, a transmission part rotationally arranged in the shell in the length direction of the shell and a telescopic part arranged in the shell, the power input end of the transmission part freely penetrates out of the shell and then is connected with the operation part, and the power output end of the transmission part is connected with the telescopic part; the telescopic end of the telescopic piece is connected with the plurality of planting assemblies; the operation part is rotated to drive the telescopic end of the telescopic part to move through the transmission part so as to change the distance between the planting assemblies.
Owner:ZIGUI YIXIN AGRI DEV CO LTD

Dpo rt-pcr primer set, detection method, kit for detecting five citrus viruses and application thereof

The application discloses a DPO RT-PCR primer group for synchronously detecting five citrus viruses, a detection method, a kit and application of the DPO RT-PCR primer group, and sequences of the primer group are shown as SEQ ID NO. 1-SEQ ID NO. 10. The application designs specific DPO RT-PCR primers for citrus tristeza virus, citrus tatter leaf virus, citrus yellow vein clearing virus and citrus leaf mottle virus, and the detection primers can effectively remove primer dimer interference, and the five viruses can be detected from samples at the same time. The detection method is simple and efficient, and only needs to use a common PCR instrument and an electrophoresis instrument to detect, and has the characteristics of rapidness, economy, high accuracy and high sensitivity, and can be used for large-scale screening of field citrus plants and epidemic prevention detection before seedling transportation, and provides technical support for healthy seedling detection and field screening of diseases.
Owner:GUANGXI ZHUANG AUTONOMOUS REGION ACAD OF AGRI SCI

Method for improving citrus Huanglongbing resistance by using clpsa n gene

The application discloses a method for improving the resistance of citrus to Huangyanbing by using ClPsaN gene, comprising the following steps: (1) cloning a VIGS fragment of the citrus ClPsaN gene; (2) constructing two VIGS expression vectors of TRV and CLBV; and (3) transforming the VIGS expression vector into citrus to obtain VIGS plants in which the citrus ClPsaN gene is silenced. According to the method, the VIGS vector of the citrus ClPsaN gene is constructed, then the vector is transformed into citrus, and the obtained citrus plants can obviously show resistance to Huangyanbing. The titer of Huangyanbing, i.e., Huangyanbing yellow vein-illness virus, can be reduced by 22-34%, and the accumulation amount of virus protein can be reduced by 35-50%, so that the incidence of Huangyanbing is significantly reduced. In addition, the TRV silencing of the citrus ClPsaN gene does not affect the phenotype of the citrus plants, and the citrus ClPsaN gene can be used as a candidate gene to be used in the breeding of citrus plants resistant to Huangyanbing by using VIGS silencing, RNA interference and gene editing technologies in cooperation with multiple genes of the citrus plants resistant to or susceptible to Huangyanbing.
Owner:GERMPLASM INNOVATION GRAND SCIENCE CENTER OF WESTERN CHINA (CHONGQING) SCIENCE CITY +1

Insect prevention device for citrus planting greenhouse

The utility model relates to the technical field of insect prevention devices, and discloses an insect prevention device for a citrus planting greenhouse, which comprises an outer shell and an insect prevention box, the upper end of the outer shell is fixedly provided with a fixed column, the lower end of the outer shell is movably provided with a material conveying port, one end of the material conveying port is movably connected with an insect killing box, and the other end of the material conveying port is movably connected with a water pump. A flame projector is fixedly installed on one side of the inner wall of the deinsectization box, a material conveying opening is movably sleeved with a hose, the other end of the hose is movably sleeved with a connecting pipe, the lower end of the connecting pipe is movably connected with a two-way air suction pump, and a sliding way is formed in a groove in the lower end of the outer shell. The sliding head and the sliding way are used in cooperation, the sliding head can be driven to move on the sliding way by means of free movement of the sliding wheel of the sliding head on the sliding way, the sliding head is fixedly connected with the insect prevention box through the connecting rod, the insect prevention box can move within a certain range below the outer shell, the insect killing range can be widened, and therefore the insect killing rate of the device is improved.
Owner:GUANGXI SUBTROPICAL CROPS RESEARCH INSTITUTE(GUANGXI SUBTROPICAL AGRICULTURAL PRODUCTS PROCESSING RESEARCH INSTITUTE)

A method for improving citrus resistance to bacterial wilt based on gene interference

The application provides a method for improving the resistance of citrus to canker disease based on gene interference, which comprises the following steps: introducing a long-chain fatty alcohol oxidase gene in a citrus plant into an interference vector as an interference sequence, and integrating the interference sequence into the citrus genome by means of agrobacterium-mediated genetic transformation, so as to effectively improve the resistance of the citrus to canker disease. CsFAO3 The part of the coding sequence of the gene, i.e., the sequence as shown in SEQ ID NO: 3, is used as an interference sequence, introduced into an interference vector, and integrated into the citrus genome by means of agrobacterium-mediated genetic transformation, so as to effectively improve the resistance of the citrus to canker disease. The method can directly inhibit most of the pathogenic bacteria causing the canker disease of the citrus, the gene to be interfered with can greatly improve the resistance of the citrus to the canker disease while reducing the adverse effects on the known quality and performance of the citrus to the greatest extent, a new way for the breeding of the citrus resistant to the canker disease is opened up, and the development of the breeding of the citrus resistant to the canker disease is promoted.
Owner:SOUTHWEST UNIV

A volatile chemical-based butterfly adult moth sex attractant and methods of making and using the same

This invention discloses a butterfly adult directional attractant based on volatile chemical substances, along with its preparation and application methods. The invention uses a combination of readily available chemical reagents, such as linalool, as volatile signaling substances to efficiently induce various butterfly adults, including the Common Mormon and the Citrus Swallowtail, which use citrus plants (Rutaceae family) as hosts, to complete forward directional movements through flight or walking. This method can induce the synchronized directional movements of multiple butterflies of various species at a relatively low cost, and has significant practical value for human-butterfly interaction projects in ecological landscape construction and recreational experience settings.
Owner:JIANGSU ACAD OF AGRI SCI

Plant squeezing equipment for essence refining

The invention relates to the technical field of plant squeezing, and discloses plant squeezing equipment for essence refining, which comprises a support and a screen drum rotatably arranged on the support, and a feeding auger for extracting citrus plant essence, a driving part and a cleaning part arranged on the support are arranged in the screen drum. A plurality of through holes are formed in the circumferential outer wall of the screen drum, frustums are irregularly arranged on the circumferential inner wall of the screen drum, the feeding auger is divided into a shaft rod and spiral blades, the diameter of the shaft rod is gradually increased from front to back, a cavity is formed in the shaft rod, and a puncturing piece is arranged in the cavity. The plant squeezing equipment for essence refining can effectively solve the problems that in the prior art, due to the fact that the squeezing equipment completely stops working in the residue removing period, the production takt is obviously stopped, the smoothness of the whole squeezing process is directly damaged due to a discontinuous working mode, and the production efficiency is greatly improved. The problems of low equipment output efficiency and unstable essential oil extraction are further caused.
Owner:JIANGXI RUNJINGKANG BIOTECHNOLOGY CO LTD

A primer and method for identifying citrus fruits with low temperature induced color potential

The application discloses a primer and a method for identifying whether citrus fruits have low-temperature color promoting potential. CitHB7 After the specific primer designed for the promoter is used for PCR amplification reaction on the DNA of the citrus plant, whether the fruit has the low-temperature color promoting potential after harvesting is judged according to the target band after amplification. The citrus plant with the 750 bp target band has the low-temperature color promoting potential after harvesting; the citrus plant with the 100 bp target band does not have the low-temperature color promoting potential. The method provided by the application can quickly identify whether the citrus fruit has the low-temperature color promoting potential, and provides guarantee for accurate application of the low-temperature color promoting technology in postharvest treatment of the citrus fruit.
Owner:HUAZHONG AGRI UNIV

A method for improving high temperature resistance of citrus by exogenous spraying of naringin

This invention discloses a method for enhancing the high-temperature resistance of citrus through exogenous spraying of naringin, belonging to the field of agricultural technology. The method involves preparing naringin into a formulation and spraying it exogenously onto the leaves of citrus plants. Experiments show that after treatment with naringin, phenotypic damage such as wilting and curling of citrus seedling leaves under high-temperature stress is significantly alleviated; the maximum photochemical efficiency of photosystem II (Fv / Fm) is significantly increased; electrolyte leakage rate and malondialdehyde content are significantly reduced; and the accumulation of hydrogen peroxide and superoxide anions is effectively inhibited. This invention utilizes naturally sourced naringin to significantly enhance the tolerance of citrus to high-temperature stress through multiple mechanisms, including maintaining photosynthetic system function, protecting cell membrane integrity, inhibiting membrane lipid peroxidation, and scavenging reactive oxygen species. Furthermore, the method is simple to operate, environmentally friendly, and low-cost, making it suitable for stress-resistant citrus cultivation.
Owner:HUAZHONG AGRI UNIV

A deep learning-based method and device for detecting citrus psylla

The application discloses a kind of citrus psylla intelligent detection method and device based on deep learning, method includes the following steps: S1, acquisition citrus psylla color image under natural orchard scene, pre-treatment is carried out to acquisition image, and citrus psylla dataset is made;S2, improvement YOLOv5-s network model, using citrus psylla dataset is iteratively trained to improved YOLOv5-s network model, and optimal model is obtained and used as psyllid detection model;S3, using 2 pairs of servo steering engine is formed rotatable holder and carries variable zoom camera and forms image collector;Psyllid detection model is deployed to embedded device, and using the equipment control image collector;S4, the image obtained by image collector is input into psyllid detection model and is identified, determines whether there is citrus psylla in the image photographed and its position.The method and device of the application can be deployed in natural orchard, and the citrus plants in a certain distance range are efficiently and intelligently monitored to determine whether there is citrus psylla.
Owner:SOUTH CHINA AGRICULTURAL UNIVERSITY

Control of citrus huanglongbing in citrus plants using combination of oxytetracycline and streptomycin

PendingCN121693266ABiocideSugar derivativesCitrus volkamerianaOrange Tree
The present disclosure relates generally to methods and systems for controlling Candidatus Liberobacter Disease in citrus plants, including, for example, orange trees. In some embodiments, the methods comprise injecting an injection formulation comprising a combination of oxytetracycline and streptomycin into a tree.
Owner:INVAIO SCIENCES INC

Organic fertilizer and soil loosening device for citrus orchard

The utility model relates to citrus planting technical field, specifically disclose a kind of citrus orchard using organic fertilizer and soil loosening device for applying, including support chassis, its upper surface is fixedly connected with fertilizer storage barrel, the upper surface of fertilizer storage barrel is installed with feed opening, the upper surface of support chassis is fixedly connected with feeding pump, the surface of feeding pump is installed with guide pipe, the lower end of guide pipe is through support chassis surface, and the lower end of guide pipe is fixedly connected with fertilization connecting frame, and the first linkage wheel is installed in support chassis lower end.This citrus orchard uses organic fertilizer and soil loosening device for applying, realizes soil loosening and fertilization synchronous, solve the problem that traditional device needs step-by-step operation, when soil turning mechanism is driven soil turning connecting wheel soil turning, fertilization connecting frame can synchronous drop fertilizer, make fertilizer directly and loose soil fully mix, improve operation efficiency and fertilizer absorption effect.
Owner:大理白族自治州农业科学推广研究院

Ptrsaury32 gene and application in enhancing citrus root growth

The application discloses a PtrSAUR32 gene and application thereof in enhancing growth of citrus root, relates to the field of agricultural biological genes, and solves the technical problem of a technical blank in the prior art in regulating growth of the citrus root by using SAUR; the coding sequence of the PtrSAUR32 gene is a nucleotide sequence as shown in SEQ ID NO.1; the transgenic plant with enhanced root growth is obtained by cloning the coding sequence of the PtrSAUR32 gene, constructing a PtrSAUR32 overexpression vector, genetically transforming the citrus by using the PtrSAUR32 overexpression vector, and identification; the application improves the expression level of the PtrSAUR32 based on the PtrSAUR32 overexpression, and obtains the transgenic citrus plant with enhanced root growth; the root length of the plant is significantly higher than that of a control plant, and the plant has great application value in improving the citrus rootstock and enhancing the stress resistance of the citrus.
Owner:SOUTHWEST UNIV

Planting pit digging device

The utility model relates to the technical field of citrus planting pit digging devices, and discloses a planting pit digging device which comprises a machine box, a baffle and a pit digging structure, a first motor and a second motor are fixedly arranged at the front position of the upper end of the machine box, a fixing sleeve block is hinged to the upper side of the baffle, and a torsion spring is arranged at the hinged position of the fixing sleeve block and the baffle. A first inner groove is formed in the position, close to one side, of the interior of the baffle, a first spring is fixedly arranged on the inner wall of one side of the first inner groove, a first fixing plate is fixedly arranged at one end of the first spring, and an inserting block is fixedly arranged at one end of the first fixing plate; and a sleeve rod is rotationally arranged at the front part in the connecting plate. According to the device, the pit digging structure is arranged, so that soil can be conveniently dug, the cover body is arranged to prevent the soil from collapsing into the pit, a nutrient solution can be immediately added into the pit after the pit digging, and the device is convenient to use.
Owner:YUNNAN ZHIHE AGRI DEV CO LTD

Application of spearmint oil and spearmint oil-containing compositions in the control of citrus Huanglongbing (HLB)

This invention discloses the application of spearmint oil and spearmint oil-containing compositions in the control of citrus Huanglongbing (HLB), belonging to the field of agricultural disease control. This invention provides the application of spearmint oil in inhibiting the pathogen of citrus HLB. Addressing the problem of the lack of effective green control methods for citrus HLB, this invention screened a fungicide of the pathogen of citrus HLB from a natural plant-derived active substance. Spearmint oil not only has a significant direct inhibitory and killing effect on the pathogen of citrus HLB, but also induces systemic resistance in citrus plants and enhances tree vigor. The spearmint oil of this invention is derived from natural plants, has clearly defined main components, is biodegradable in the environment, has extremely low residue risk, and meets the requirements of green agriculture and safe agricultural production.
Owner:GUO WUYANG (HUNAN) BIOTECHNOLOGY CO LTD

Agrobacterium tumefaciens strain and derivatives thereof

The disclosure relates to novel disarmed Agrobacterium tumefaciens strains, uses of these disarmed Agrobacterium strains, and kits comprising such disarmed Agrobacterium strains. The disarmed Agrobacterium strains are effective for the transformation of plant, fungal, or algae cells. The Agrobacterium strains are very effective for the transformation of citrus plant cells.
Owner:THE GOVERNMENT OF THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY DEPARTMENT OF HEALTH & HUMAN SERVICES

Application of citrus CgABR gene in regulating fruit base length of pomelo fruit

The application discloses application of a citrus CgABR gene in regulating fruit base length of a grapefruit. The application proves for the first time that the CgABR gene negatively regulates the fruit base length of the grapefruit. The application further takes tomatoes as a model to prove through experiments that, compared with the fruit base length of a wild type plant, the fruit base length of a T2 generation positive plant fruit overexpressing the CgABR is significantly shortened, which lays a foundation for improving citrus plants, especially grapefruit plants, in fruit shape by using genetic engineering and provides a new gene resource.
Owner:YULIN NORMAL UNIVERSITY

Use of a nematicide composition

A method of phytosanitary treatment, which includes the step of administering a nematicidal composition, is disclosed. The nematicidal composition includes cinnamic aldehyde and terpene alcohol as active ingredients as a nematicide in a phytosanitary treatment, particularly in crops of banana, plantain, table and wine grapes, fruit trees, citrus plants, strawberries, and soy. Main advantages of the invention include high efficacy against nematodes, great stability over time, and the very low toxicity of the composition, both for plants and humans.
Owner:DESARROLLO AGRI Y MINERO SA

Create huanglongbing tolerance by silencing a citrus negative immune regulator

Disclosed are methods for inducing tolerance to Huanglongbing (HLB) in citrus plants. It was found that silencing negative regulators of the plant immune system will provide resistance or tolerance to diseases, particularly HLB. NPR3 is silenced using citrus tristeza virus-based plant mediated RNA interference (CTV-RNAi) to create citrus plants that are resistance to HLB. Also disclosed are CTV-RNAi vectors designed to silence negative regulators of the plant immune system.
Owner:UNIV OF FLORIDA RESEARCH FOUNDATION INC

Method for improving canker resistance of citrus by using CsFKBP16-4 gene

The invention discloses a method for improving canker resistance of citrus by using a CsFKBP16-4 gene, and relates to the field of molecular biology, the transcriptional level of the FKBP16-4 gene in citrus plants is reduced by interfering RNA, and the nucleotide sequence of the interfering RNA is as shown in SEQ ID NO: 1. A part of coding sequence of the CsFKBP16-4 gene is used as an interference sequence, is introduced into an interference vector, and is integrated into a citrus genome through an agrobacterium-mediated genetic transformation method, so that the canker resistance of citrus is effectively improved. The canker attack degree of the obtained transgenic plant can be reduced to 28.3% of that of the existing citrus, the canker symptom of the transgenic citrus is remarkably relieved, and the canker resistance of the citrus is improved. In addition, transgenic citrus plants can directly inhibit proliferation of pathogenic bacteria causing canker, the canker can be ensured to be inhibited essentially, another way for citrus canker-resistant breeding is opened up, and development of citrus canker-resistant breeding is promoted.
Owner:GERMPLASM INNOVATION GRAND SCIENCE CENTER OF WESTERN CHINA (CHONGQING) SCIENCE CITY

Application of transgreen peptide in relieving iron deficiency chlorosis of citrus leaf

The present application relates to the technical field of citrus cultivation, and particularly relates to application of a green transition peptide in relieving iron deficiency chlorosis of citrus leaves, and application of the green transition peptide in a product for relieving iron deficiency chlorosis of citrus leaves. An amino acid sequence of the green transition peptide is NTLISKVLNKGDAFVFPIGLIHFQFNIGK. The green transition peptide is applied to promote absorption and transport of iron elements by citrus plants, the green transition peptide and EDDHA-iron can play a synergistic effect, relieve iron deficiency chlorosis of citrus, increase iron content and chlorophyll content of leaves, improve photosynthetic rate, increase fruit content, and improve fruit quality.
Owner:CHENGDU LUSYNO BIOTECHNOLOGY CO LTD