21 results about "Vibrio splendidus" patented technology

The application belongs to the technical field of molecular biology, and particularly relates to a long oyster C-type lectin CgCLec-TM2 functional domain CRD recombinant protein and application. The amino acid sequence of the long oyster C-type lectin CgCLec-TM2 functional domain CRD recombinant protein is shown as SEQ ID NO. 1. The rCRD obtained by the application has binding capacity to various pathogen-associated molecular patterns (PAMPs), can bind and agglutinate various microorganisms, has a growth inhibiting effect on gram-negative bacteria Vibrio splendidus and Escherichia coli, and can be used for the development of bacteriostatic feed additives and new-type immune enhancers.

The invention discloses a preparation method and application of a vibrio outer membrane protein A multi-epitope antigen and a recombinant antigen thereof, and is characterized in that a protein multi-epitope antigen sequence synthesized by outer membrane proteins of vibrio splendidus, vibrio parahaemolyticus and vibrio alginolyticus is designed by utilizing a multi-epitope technology, and the amino acid sequence of the protein multi-epitope antigen sequence is shown as SEQ ID NO.4; the preparation method of the multi-epitope recombinant antigen comprises the following steps: synthesizing a multi-epitope gene according to a multi-epitope antigen amino acid sequence, connecting the multi-epitope gene to a pET-28a (+) vector, transforming a plasmid containing the multi-epitope gene into a protein expression type competent cell, screening out positive clones, and performing protein expression; the method comprises the following steps: carrying out protein purification by using affinity chromatography to obtain a multi-epitope recombinant antigen, further preparing a multi-epitope antibody by using the multi-epitope recombinant antigen, and detecting whether a to-be-detected sample solution contains vibrio or not by using the multi-epitope antibody as a labeled protein and using a trace thermophoresis technology, so that the method has the advantages of high detection speed and strong specificity.

The invention provides an antibacterial peptide ATMP23 mutant with improved antibacterial activity and application of the antibacterial peptide ATMP23 mutant in preparation of an antibacterial agent. The amino acid sequence of the antibacterial peptide ATMP23 provided by the invention is shown as SEQ ID NO: 1, amino acid mutation and screening are carried out on the basis of the amino acid sequence, and antibacterial peptide mutants A23-M4, A23-M5 and A23-M6 with significantly improved antibacterial activity are obtained. The antibacterial peptide ATMP23 mutant provided by the invention is small in molecular weight, convenient to artificially synthesize and low in cost, and has a good bactericidal effect on clostridium welchii, staphylococcus aureus, streptococcus, vibrio parahaemolyticus, vibrio alginolyticus, vibrio splendidus, salmonella, escherichia coli and the like; when being applied to livestock and aquatic feed, the feed conversion ratio of livestock and aquatic products can be remarkably reduced, the growth performance and immune function indexes of bred animals can be improved, and the feed additive can be widely applied to the industries of feed, food, medicine and the like.

The invention discloses a recombinant crassostrea gigas complement C3 cleavage fragment rCgC3dg as well as a preparation method and application thereof. The amino acid sequence of the rCgC3dg is shown as SEQ ID NO. 1; the preparation method comprises the following steps: carrying out PCR (Polymerase Chain Reaction) amplification on a Crassostrea gigas CgC3dg coding region fragment by using primers P1 and P2, wherein the DNA (Deoxyribose Nucleic Acid) sequence of the primer P1 is as shown in SEQ ID NO. 2, and the DNA sequence of the primer P2 is as shown in SEQ ID NO. 3; respectively carrying out BamHI and Xhol I enzyme digestion on a PCR amplification product and a pET-30a carrier, and then connecting and transforming through T4 ligase to construct a recombinant; transferring the recombinant into an escherichia coli Transsetta (DE3) expression strain, culturing the expression strain, adding IPTG (isopropyl-beta-d-thiogalactoside) to carry out induced expression on the recombinant protein, and then purifying and renaturating to obtain the recombinant rCgC3dg protein. The recombinant crassostrea gigas complement C3 split fragment rCgC3dg and rCgGSDME-N can be used for preparing a medicine for resisting vibrio splendidus and escherichia coli after being mixed.

The invention provides an antibacterial peptide ATMP23 with improved antibacterial activity, a mutant of the antibacterial peptide ATMP23 and application of the antibacterial peptide ATMP23 in preparation of an antibacterial agent. The amino acid sequence of the antibacterial peptide ATMP23 provided by the invention is shown as SEQ ID NO: 1, amino acid mutation and screening are carried out on the basis of the amino acid sequence, and antibacterial peptide mutants A23-M1, A23-M2 and A23-M3 with significantly improved antibacterial activity are obtained. The antibacterial peptide ATMP23 provided by the invention is small in molecular weight, convenient to artificially synthesize and low in cost, has a good bactericidal effect on vibrio splendidus, vibrio alginolyticus, vibrio parahaemolyticus, streptococcus agalactiae, streptococcus iniae, staphylococcus aureus, escherichia coli and the like, and can remarkably reduce the feed conversion ratio of livestock, poultry and aquatic products when being applied to livestock, poultry and aquatic feed; and the feed additive can improve the indexes of growth performance and immune function of bred animals, can be widely applied to the industries of feed, food, medicine and the like, and has a good market application prospect.

The invention belongs to the technical field of biochemistry and biological medicine, and discloses an antibacterial neuropeptide Urocortin III and application thereof, and the antibacterial neuropeptide Urocortin III has an amino acid conserved sequence of xxxTLSLDVPTNxMNxLFxxxKAKNxRAxAxxNAxLx AQI-NH2. The antibacterial neuropeptide Urocortin III synthesized by the invention has obvious inhibition and killing effects on important pathogenic bacteria of fishes and human beings, such as vibrio splendidus, vibrio harveyi, streptococcus agalactiae, bacillus subtilis, escherichia coli and staphylococcus aureus, and has relatively good inhibition and killing effects on gram-positive bacteria and gram-negative bacteria; the compound can be used for research and development of novel bacteriostatic and bactericidal drugs or compositions, and has good application prospects in the fields of aquatic fishery drugs, fish feeds, human food additives, cosmetics, medicines and the like.

The invention discloses an antibacterial peptide as well as a synthesis method and application thereof, and belongs to the field of antibacterial peptides. The sequence of the antibacterial peptide is as follows: F23IHHIFNGIANVGRMIHGIV42, and the sequence of the antibacterial peptide is as follows. The synthetic method of the antibacterial peptide comprises the following steps: obtaining the full-length cDNA of the Piscidin gene, designing the antibacterial peptide, and synthesizing the antibacterial peptide. The micropterus salmoides strain is applied to the aspect of micropterus salmoides antibiosis, solves the problem that the development of the micropterus salmoides culture industry is restricted due to drug resistance and water environment pollution caused by the fact that antibiotic drugs are adopted by the existing micropterus salmoides to prevent diseases, and has a relatively strong specific immune function on aeromonas hydrophila and vibrio splendidus.

The application discloses a Pseudomonas australis 94-6Y strain, a bacterial agent and application thereof, and belongs to the technical field of microorganisms. Fictibacillus macauensis The Pseudomonas australis 94-6Y strain is classified and named as Pseudomonas australis, the strain number is 94-6Y, the preservation number is CGMCC No.32718, the strain is a gram-positive strain, the colony is milky white, nearly round, opaque, the surface is slightly rough, and has no luster. The Pseudomonas australis 94-6Y strain can significantly inhibit the water production breeding pathogenic bacteria Vibrio vulnificus, Vibrio splendidus and Vibrio alginolyticus; meanwhile, it is proved that the Pseudomonas australis 94-6Y strain has the ability of efficiently reducing ammonia nitrogen, nitrite nitrogen and chemical oxygen demand in breeding water, is helpful to reduce the breeding disease risk coefficient, improves the breeding water environment, and has important significance for strengthening the research and development of microecological preparation products and popularization of the ecological healthy breeding mode.

The present invention belongs to the technical field of molecular biology and relates to a recombinant protein rCgDM9CP-7 from the Pacific oyster Crassostrea gigas containing a DM9 domain and its application. The amino acid sequence of the recombinant protein rCgDM9CP-7 from the Pacific oyster Crassostrea gigas containing a DM9 domain is shown in SEQ ID NO.1; an amino acid sequence having a homology of greater than or equal to 90% thereto. The application of the recombinant protein in preparing an agglutination preparation for Vibrio splendidus, Escherichia coli, Staphylococcus aureus or Bacillus subtilis to inhibit the growth of the strains.

The application discloses a whole-genome SNP molecular marker combination related to the apraocha of sea cucumber against vibrio splendidus and application thereof, wherein the SNP molecular marker combination comprises 35 SNP sites, and in disease-resistant breeding, individuals with the 35 SNP site dominant genotypes can be screened to accelerate the breeding process of the disease-resistant traits. The molecular marker provided by the application has high biological correlation and prediction accuracy in breeding, and can be screened through DNA detection without relying on the phenotype of individual infection and disease, so that the generation interval is greatly shortened, the breeding efficiency is improved, the molecular marker assisted selection can overcome environmental interference, the genotypes are directly selected, the selection strength is high, the accuracy is high, and the genetic progress of the disease-resistant traits is accelerated.

The invention belongs to the technical field of biochemistry and biological medicine, and discloses a neuropeptide UTS1 variant which is [R39, K40]-UTS1, the [R39, K40]-UTS1 is obtained by optimizing 39 and 40 amino acid sites of the neuropeptide UTS1 into R and K, and the amino acid conserved sequence of the [R39, K40]-UTS1 is SEEPPLSIDLTFHLLRNMIQMAKMESQREQAQLNRKVLRKV-NH2. The [R39, K40]-UTS1 provided by the invention has obvious effects of inhibiting and killing vibrio splendidus, vibrio harveyi, bacillus subtilis, streptococcus agalactiae, escherichia coli and staphylococcus aureus, has a better inhibiting effect on gram-positive bacteria and gram-negative bacteria, can be used for researching and developing novel bacteriostatic and bactericidal drugs or compositions, and has wide application prospects. The method has good application potential in the fields of aquatic fishery medicines or human cosmetics, medicines and the like.

The invention discloses an antibacterial peptide for preventing and treating black mouth disease of cultured sea urchin and application thereof, the amino acid sequence of the antibacterial peptide for preventing and treating black mouth disease of cultured sea urchin is VDTAHKGEVYPIGKAECPIP, and the antibacterial peptide can generate specific interaction with cell membrane of vibrio splendidus, which is the pathogenic bacterium of black mouth disease of strongylocentrotus intermedius, so that the integrity of the cell membrane of vibrio splendidus is destroyed, and the antibacterial peptide can be used for preventing and treating black mouth disease of cultured sea urchin. The minimum inhibitory concentration is 50 mg / mL, and the strain can be used as a feed additive for preparing a feed for culturing the sea urchin so as to prevent and treat the black mouth disease of the cultured sea urchin, and has a good application prospect.

The invention provides a method for inhibiting vibrio splendidus virulence factors by using 5-iodoindole and application of the 5-iodoindole, and finds that 5-iodoindole with different concentrations can obviously reduce the expression of the virulence factors such as hemolytic activity and protease activity of vibrio splendidus on the premise of basically not influencing the growth of the vibrio splendidus. According to the method, the infection toxicity of vibrio splendidus can be weakened, so that the infection and morbidity probability of the host stichopus japonicus is reduced, and the infection symptom is relieved. Meanwhile, the invention further provides application of the 5-iodoindole in reducing expression of vibrio splendidus related virulence genes and improving the survival rate of host stichopus japonicus after vibrio splendidus challenge, and it is proved that the 5-iodoindole with the concentration of 20 [mu] M has guiding significance in actual stichopus japonicus production and breeding. And the vibrio splendidus virulence factor is researched, so that the infection and morbidity of the stichopus japonicus caused by the vibrio splendidus can be reduced.

The invention provides a method for improving vibrio splendidus infection resistance of stichopus japonicus, which is a method for preventing and treating stichopus japonicus diseases caused by vibrio splendidus by inhibiting pathogenesis related to vibrio splendidus outer membrane vesicles. The composition capable of improving the vibrio splendidus infection resistance of the stichopus japonicus comprises chlorpromazine and nystatin. The composition provided by the invention has no obvious toxicity to coelomic cells of the stichopus japonicus, and can inhibit endocytosis of OMVs to the maximum extent, so that the optimal prevention and control effect is realized. After the OMVs are treated by chlorpromazine and nystatin, the endocytosis efficiency of the OMVs is reduced by more than 50%.

The invention discloses a strain of Australian pseudobacillus 94-6Y as well as a microbial agent and application thereof, and belongs to the technical field of microorganisms. The invention provides a strain of pseudomonas macaurae 94-6Y, which is classified and named as pseudomonas macaurae, the strain number is 94-6Y, the preservation number is CGMCC (China General Microbiological Culture Collection Center) No.32718, the strain is a gram-positive strain, and the bacterial colony is milk white, nearly round, opaque, slightly rough in surface and matte. The pseudomonas australis 94-6Y is capable of remarkably inhibiting aquaculture pathogenic bacteria vibrio vulnificus, vibrio splendidus and vibrio alginolyticus; meanwhile, the invention also proves that the pseudobacillus Australiae 94-6Y has the capability of efficiently reducing ammonia nitrogen, nitrite nitrogen and chemical oxygen demand of the culture water body, is beneficial to reducing the risk coefficient of culture diseases and improving the environment of the culture water body, and has important significance on enhancing the research and development of microecological preparation products and popularizing an ecological healthy culture mode.

The present application relates to aquaculture technology, in particular to a method for improving the growth and development speed and antibacterial ability of long oyster larvae by using taurine. The taurine soaking treatment of long oyster shell top larvae can promote the growth of larvae, accelerate the attachment metamorphosis process, and improve the survival rate after infection of Vibrio splendidus. The present application proves that taurine can improve the growth and development speed and immune defense ability of long oyster larvae, and has broad application prospects in shortening the oyster breeding cycle, improving the success rate and seed quality of breeding, promoting the green development of oyster culture industry, etc.

The invention provides a functional gene capable of maintaining immune memory of stichopus japonicus. The amino acid sequence of a protein coded by the functional gene is SEQ ID NO: 2. The gene is activated when the stichopus japonicus is infected by low-concentration vibrio splendidus, and can keep a relatively stable expression level; by regulating and controlling the metabolic pathway of the immune memory cells, the immune memory cells are converted to the glycolysis direction, so that rapid and sufficient energy support is provided for immune response; meanwhile, the gene can also effectively enhance the phagocytic function of coelomic cells of the stichopus japonicus, and obviously improve the ability of the stichopus japonicus to remove pathogenic microorganisms. Discovery and application of the gene provide a new molecular basis for research on a maintenance mechanism of immune memory of the stichopus japonicus, and lay a theoretical and practical foundation for prevention and control of stichopus japonicus diseases and development of a novel immune regulation method.

The application provides application of indole-3-lactic acid in improving immunity of sea cucumber and inhibiting virulence factors of Vibrio splendidus. The application is used for preparing a product for inhibiting virulence factors of Vibrio, and a product for improving immune defense ability of aquatic animals; wherein the aquatic animals are preferably sea cucumber, and the Vibrio is preferably Vibrio splendidus. Researches show that under the premise of basically not affecting the growth of Vibrio splendidus, the indole-3-lactic acid can significantly reduce hemolytic activity, protease activity, motility and biofilm formation of the Vibrio splendidus, and can reduce intestinal permeability of the sea cucumber, repair intestinal physical barrier, relieve excessive inflammatory response induced by Vibrio splendidus infection, thereby improving survival rate of the sea cucumber after attack and reducing incidence probability. The technology has the advantages of small dosage, clear effect, green safety and low drug resistance selection pressure, and is suitable for prevention and control of sea cucumber skin rot syndrome.

The invention relates to application of FeSO4 in preparation of drugs or feeds for promoting apostichopus japonicus coelomocyte phagocytosis activity, and belongs to the field of aquaculture, the application method is as follows: ferrous sulfate is added in the drugs or feeds to improve expression of hsp70 and c3 genes in apostichopus japonicus bodies, so that the pathogen removal capacity of apostichopus japonicus is improved, and the apostichopus japonicus coelomocyte phagocytosis activity of apostichopus japonicus is improved. Meanwhile, by adjusting a tlr3 gene mediated immune signal channel, the recognition capability of the stichopus japonicus on exogenous pathogens is promoted, so that the non-specific immunity of the stichopus japonicus can be remarkably enhanced. The stichopus japonicus skin ulcer syndrome is prevented by utilizing the function and the killing function of FeSO4 on vibrio splendidus in a water body.

The present application provides a method and application of 5-iodoindole inhibiting virulence factors of Vibrio splendidus, and it is found that different concentrations of 5-iodoindole can significantly reduce the expression of virulence factors such as hemolytic activity and protease activity of Vibrio splendidus under the premise of basically not affecting the growth of Vibrio splendidus. Through the method, the infection toxicity of Vibrio splendidus can be weakened, so as to reduce the infection and disease probability of host sea cucumber and alleviate the infection symptoms. Meanwhile, the present application also provides the application of 5-iodoindole in reducing the expression of Vibrio splendidus related virulence genes and the application of 5-iodoindole in improving the survival rate of host sea cucumber after Vibrio splendidus attack, which proves that 5-iodoindole with a concentration of 20 muM has guiding significance for actual sea cucumber production and culture. And through the research on virulence factors of Vibrio splendidus, the present application is helpful to reduce the infection and disease of sea cucumber caused by Vibrio splendidus.

The invention relates to an aquaculture technology, in particular to a method for improving growth and development speed and antibacterial ability of crassostrea gigas larvae by using taurine. The crassostrea gigas shell top larvae are soaked with taurine, so that the growth of the larvae can be promoted, the attachment and metamorphosis process can be accelerated, and the survival rate after vibrio splendidus infection can be improved. The taurine is proved to be capable of improving the growth and development speed and the immune defense capability of the crassostrea gigas larvae, and has wide application prospects in the aspects of shortening the crassostrea gigas breeding period, improving the breeding success rate and the quality of the larvae, promoting the green development of the crassostrea gigas breeding industry and the like.