16 results about "Chlorosis" patented technology

The invention relates to the technical field of microorganisms, in particular to a strain of Senotrophomonas sepilia DB3 with disease-resistant, iron-dissolving and growth-promoting functions and application thereof, and the strain is separated from calcareous soil pear tree rhizosphere and has good capabilities of producing IAA (Indoleacetic Acid), quickly growing, dissolving insoluble iron, producing iron carriers and effectively antagonizing various pathogenic bacteria. Pot experiments show that the DB3 microbial inoculum can significantly promote growth of peanut and pyrus betulaefolia seedlings, improve root development and iron nutrient content, enhance leaf SPAD value and iron absorption and relieve iron-deficiency yellows, can be used for preparing biological bacterial fertilizers and reducing chemical iron fertilizer investment, and has good development and application prospects.

The invention discloses a transcription factor ZmbHLH180 gene as well as an encoded protein and application thereof, and relates to the technical field of plant genetic engineering, the nucleotide sequence of the corn ZmbHLH180 gene is shown as SEQ ID NO.1, and the amino acid sequence of the encoded protein is shown as SEQ ID NO.2. The invention provides a transcription factor ZmbHLH180 gene, the CDS full length of the gene is 864bp, 287 amino acids are encoded, the gene is mainly positioned in a cell nucleus, and the expression of a chlorophyll degradation gene NYC1 and the senescence of leaves can be obviously promoted by over-expressing the ZmbHLH180 gene in arabidopsis thaliana; the trans-ZmbHLH180 gene overexpressed corn can remarkably promote leaf greening under drought stress, a certain technical foundation is laid for regulation and control of the plant growth cycle, a choice is provided for genetic improvement of new plant varieties, and the application value is important.

The invention relates to the technical field of plant growth-promoting bacteria and soil-borne disease biological control, in particular to a bacillus velezensis 1708Y11-01 strain and application thereof. According to the bacillus velezensis 1708Y11-01 and the application thereof, the bacillus velezensis 1708Y11-01 is separated from plant rhizosphere disease-inhibiting soil, and the bacillus velezensis 1708Y11-01 has a very high control effect on fusarium wilt and root knot nematode disease, and can be used for improving the resistance of a plant system, improving the leaf chlorosis of crops caused by disease infection and promoting the growth of the crops. The bacillus velezensis 1708Y11-01 strain provided by the invention is pollution-free, residue-free and eco-friendly in the application process, and is a biocontrol strain with a good application prospect in the field of disease prevention and control.

The application discloses a kind of postharvest fruit and vegetable chlorosis delaying composite preservative and method, the effective component of the composite preservative includes the concentration of 10-60ppm chondroitin sulfate, the concentration of 10-60ppm heparin and the concentration of 10-60ppm hyaluronic acid.The application uses chondroitin sulfate, heparin and hyaluronic acid as composite preservative to treat postharvest citron, and shows synergistic effect of delaying chlorophyll content reduction of citron, inhibiting fruit chlorosis, so as to effectively delay postharvest citron shelf life, and the composite preservative of the application has the characteristics of green and efficient, effective components can be completely water-soluble, and environmental pollution cannot be generated.

The application belongs to the technical field of microorganisms and particularly relates to a strain of DB3 with disease-resistant iron-dissolving and growth-promoting functions Stenotrophomonas sepilia The strain DB3 is isolated from the rhizosphere of pear trees in calcareous soil, has good abilities of IAA production, rapid growth, dissolution of insoluble iron, iron carrier production and antagonism to various pathogenic bacteria. Through potting tests, it is shown that the DB3 bacterial agent can significantly promote the growth of peanut and pear seedlings, improve the root development and iron nutrient content, enhance the SPAD value and iron absorption of leaves, and relieve the iron deficiency chlorosis, and can be used for preparing a biological bacterial fertilizer, reducing the input of chemical iron fertilizer, and has a good development and application prospect.

The present application relates to the technical field of citrus cultivation, and particularly relates to application of a green transition peptide in relieving iron deficiency chlorosis of citrus leaves, and application of the green transition peptide in a product for relieving iron deficiency chlorosis of citrus leaves. An amino acid sequence of the green transition peptide is NTLISKVLNKGDAFVFPIGLIHFQFNIGK. The green transition peptide is applied to promote absorption and transport of iron elements by citrus plants, the green transition peptide and EDDHA-iron can play a synergistic effect, relieve iron deficiency chlorosis of citrus, increase iron content and chlorophyll content of leaves, improve photosynthetic rate, increase fruit content, and improve fruit quality.

The invention discloses a rice OsNAC096 gene and application of the rice OsNAC096 gene in regulation and control of phosphorus nutrient accumulation of leaves. The nucleotide sequence of the OsNAC096 gene is as shown in SEQ ID No: 1. The OsNAC096 gene is overexpressed in the rice body, the tip of the inverted leaf of the obtained OsNAC096-OE-1 and OsNAC096-OE-2 strains has a charred withering and chlorosis phenotype, and after the content of inorganic phosphorus in the leaves is measured, the phosphorus content of the leaves of the NAC096-OE-1 and the NAC096-OE-2 becomes high, and phosphorus accumulation occurs. Compared with a wild type plant, the OsPHT1 in the OsNAC096-OE-1 strain plant and the OsNAC096-OE-2 strain plant has the advantages that the OsPHT1 in the OsNAC096-OE-1 strain The relative expression level of the gene 1 is obviously increased, which indicates that the OsNAC096 improves the phosphorus absorption capacity of the rice to realize phosphorus accumulation.

The invention belongs to the technical field of biological genetic engineering, and particularly relates to a corn kernel development regulation gene ZmPPR299, an encoding protein thereof, an SNP (Single Nucleotide Polymorphism) site, a molecular marker and application of the molecular marker, the gene ZmPPR299 is located in a corn chromosome 5, and functional verification shows that the gene encodes a PPR protein located in chloroplast, and the molecular marker can be used for regulating the development of corn kernels. The chloroplast gene is an essential gene for regulating corn kernel development and chloroplast functions; the mutation of the gene can cause the lagging of embryo and endosperm development, the reduction of basal transfer layer cell proliferation, and the insufficient filling of starch grains and protein bodies, and finally, the results show that the grains shrink, the hundred-grain weight is obviously reduced, and the leaves of seedlings lose green. The invention also develops a specific CAPS molecular marker and a detection primer thereof based on a single base mutation site of the gene, and the genotype of the mutant can be rapidly and accurately identified. The gene resource and the molecular marker provided by the invention have important application values in analysis of a corn kernel development regulation network, development of molecular assisted breeding and creation of high-yield and high-quality new corn germplasm.

This invention discloses a highly efficient irrigation method for promoting grain filling by regulating the chlorosis trait in rice. This method involves shallow-water-drying quantitative irrigation, where water is naturally allowed to dry from a shallow water layer to a specified soil water potential before being re-irrigated to a shallow water layer, and this cycle is repeated. First, the presence of chlorosis in rice plants is determined based on a leaf color threshold. Then, for varieties exhibiting chlorosis, the degree of soil drying at each growth stage is quantitatively determined based on the panicle type of different rice subspecies and leaf age patterns. This method, by controlling field water potential, creates mild water stress on the plants, thereby regulating plant senescence (i.e., chlorosis trait). It also enhances the activity of key enzymes in sucrose-starch metabolism in the stem sheath and grains, thus promoting the translocation of assimilates from the stem sheath to the grains, increasing grain filling rate, and achieving yield increase.

Disclosed is the application of humic acid in improving the phytoremediation effect of heavy metals in water, and relates to the technical field of environmental ecological engineering. The invention discloses the application of humic acid in improving the phytoremediation effect of heavy metals in water, wherein the phytoremediation of heavy metals is to reduce the content of heavy metals in water by planting Vallisneria chinensis. Adding humic acid can slow down the chlorosis of Vallisneria vallissima leaves under heavy metal poisoning and increase the accumulation of heavy metals in Vallisneria vallissima leaves and roots. At the same time, it can also reduce the leaching ability of heavy metals in water, enhance the enzyme activities related to active oxygen metabolism in plants by stimulating the synthesis of protein and enzymes in various organs of plants, reduce the MDA concentration in plants, adjust the active oxygen content in plants, reduce the degree of membrane lipid peroxidation and enhance the resistance of plants to heavy metals.

The invention discloses a rice OsNAC4 gene and application of the rice OsNAC4 gene in regulation and control of phosphorus nutrient accumulation of leaves. The nucleotide sequence of the OsNAC4 gene is as shown in SEQ ID No: 1. The OsNAC4 gene is overexpressed in the rice body, the tip of the inverted leaf of the obtained OsNAC4-OE-1 and OsNAC4-OE-2 strains has the phenotype of scorched withering and chlorosis, and after the content of inorganic phosphorus in the leaves is measured at the same time, the phosphorus content of the leaves of the NAC4-OE-1 and the NAC4-OE-2 becomes high, and phosphorus accumulation occurs. Compared with a wild type plant, the OsPHT1 in the OsNAC4-OE-1 strain plant and the OsNAC4-OE-2 strain plant has the advantages that the OsPHT1 in the The relative expression level of the gene 1, 2 is obviously increased, which shows that the OsNAC4 improves the phosphorus absorption capacity of the rice so as to realize phosphorus accumulation.

The invention relates to the technical field of agricultural biology, in particular to a rice ACCase mutant gene D2291E and application thereof. The invention provides a rice ACCase mutant gene D2291E. According to the rice ACCase mutant gene D2291E, the nucleotide sequence of a wild rice ACCase gene is mutated at the 6873 site. The substance containing the mutant gene provided by the invention has excellent resistance to acetyl-coenzyme A inhibitor herbicides. The mutant gene is transferred into wild rice, so that the wild rice has resistance to acetyl-coenzyme A inhibitor herbicides, and a field spraying result in the three-leaf stage of the rice shows that the mutant rice containing the mutant gene can still keep normal growth and development when the concentration of the thiacloprid is more than 4 times that of the thiacloprid; the maturing rate and the growth period are not influenced, but the wild type plant is only 1-time in concentration, i.e., the plant is green and yellow and gradually withered after 5 days until the whole plant is dead.

This invention relates to the field of ecological cultivation technology of Chinese medicinal materials, specifically to a comprehensive prevention and control method for iron deficiency in *Polygonatum sibiricum* under forest cover. This invention addresses the symptoms of iron deficiency in *Polygonatum sibiricum* under forest cover by adjusting soil pH, providing effective iron supply, and combining a compound microbial agent of *Bacillus subtilis*, *Bacillus pumilus*, *Bacillus tekirae*, *Bacillus mycoides*, and *Bacillus amyloliquefaciens* with *Pseudomonas fluorescens* to release iron carriers. This fundamentally solves the problems of chlorosis and yellowish-white discoloration in young leaves, oily yellowish-brown spots on leaves, wilting of young shoots, elongated internodes, and easy lodging. Using *Polygonatum sibiricum* as the material, this invention proposes a three-step comprehensive approach to eliminate deficiency symptoms caused by iron deficiency during its ecological cultivation in forests. This allows the chloroplast thylakoid membrane and chlorophyll synthesis in *Polygonatum sibiricum* plants under forest cover to recover, photosynthesis to return to normal, and chlorophyll fluorescence kinetic parameters to a healthy state.

The invention relates to a composition with an insecticidal effect, a pesticide and application thereof, and belongs to the technical field of pest control. The composition disclosed by the invention can be used for effectively preventing and treating piercing-sucking mouthpart pests such as aleyrodid and green peach aphid. According to verification of the embodiment of the invention, in a field pesticide effect test on tomato bemisia tabaci, the control effect of the composition disclosed by the invention is as high as 93.45% after the composition is applied for 10 days; meanwhile, in the prevention and treatment of peach aphids, under the same dosage, the prevention effect after 14 days can still be maintained at a high level of 90.78%. It is fully proved that the composition is good in fast-acting property and outstanding in persistence, and recovery and rerampant of pest populations can be effectively controlled. Moreover, the composition disclosed by the invention is safe to the growth of test crops such as tomatoes and peach trees, no phytotoxicity symptoms such as dwarfing, chlorosis and malformation are observed after the composition is applied, and the composition shows good crop compatibility.

The invention discloses a method for detecting herbicide tolerance of transgenic sugarcane, and belongs to the field of detection of target traits and functional efficiency of biological breeding products. The detection method comprises the following steps: spraying a herbicide in a 4-5 leaf stage of transgenic sugarcane, spraying the herbicide in stem leaves, randomly investigating 20 plants in each plot, and determining the herbicide tolerance of the herbicide-resistant sugarcane by investigating the symptoms of phytotoxicity. The phytotoxicity symptoms comprise growth inhibition, chlorosis, blight and deformity. The method can accurately reflect the herbicide tolerance of the herbicide-resistant sugarcane in the current growth period, does not need complex detection steps, improves the detection method, and is beneficial to promoting the industrialization process of transgenic sugarcane biological breeding.

This invention belongs to the field of rapid detection of plant viruses, specifically the rapid detection of sweet potato chlorosis dwarf virus (SPCSV). It proposes an RPA primer set and probe, a reagent kit, and a method of use for detecting SPCSV. This patent is applicable to the rapid detection of SPCSV virus. One sample undergoes one RPA test reaction using a single LFD test strip to directly read the result. The experimental method is simple, rapid, and highly efficient, requiring no additional instruments, placing no restrictions on operators, and allowing the experiment to be conducted not only in the laboratory but also in the field. Alternatively, multiple samples can undergo multiple RPA tests, with results displayed via agarose gel electrophoresis. This reduces experimental costs and makes it more suitable for laboratory testing of suspected infected plants or virus-free seedlings.