3 results about "Chlorosis" patented technology

The present application relates to the technical field of citrus cultivation, and particularly relates to application of a green transition peptide in relieving iron deficiency chlorosis of citrus leaves, and application of the green transition peptide in a product for relieving iron deficiency chlorosis of citrus leaves. An amino acid sequence of the green transition peptide is NTLISKVLNKGDAFVFPIGLIHFQFNIGK. The green transition peptide is applied to promote absorption and transport of iron elements by citrus plants, the green transition peptide and EDDHA-iron can play a synergistic effect, relieve iron deficiency chlorosis of citrus, increase iron content and chlorophyll content of leaves, improve photosynthetic rate, increase fruit content, and improve fruit quality.

Disclosed is the application of humic acid in improving the phytoremediation effect of heavy metals in water, and relates to the technical field of environmental ecological engineering. The invention discloses the application of humic acid in improving the phytoremediation effect of heavy metals in water, wherein the phytoremediation of heavy metals is to reduce the content of heavy metals in water by planting Vallisneria chinensis. Adding humic acid can slow down the chlorosis of Vallisneria vallissima leaves under heavy metal poisoning and increase the accumulation of heavy metals in Vallisneria vallissima leaves and roots. At the same time, it can also reduce the leaching ability of heavy metals in water, enhance the enzyme activities related to active oxygen metabolism in plants by stimulating the synthesis of protein and enzymes in various organs of plants, reduce the MDA concentration in plants, adjust the active oxygen content in plants, reduce the degree of membrane lipid peroxidation and enhance the resistance of plants to heavy metals.

This invention belongs to the field of rapid detection of plant viruses, specifically the rapid detection of sweet potato chlorosis dwarf virus (SPCSV). It proposes an RPA primer set and probe, a reagent kit, and a method of use for detecting SPCSV. This patent is applicable to the rapid detection of SPCSV virus. One sample undergoes one RPA test reaction using a single LFD test strip to directly read the result. The experimental method is simple, rapid, and highly efficient, requiring no additional instruments, placing no restrictions on operators, and allowing the experiment to be conducted not only in the laboratory but also in the field. Alternatively, multiple samples can undergo multiple RPA tests, with results displayed via agarose gel electrophoresis. This reduces experimental costs and makes it more suitable for laboratory testing of suspected infected plants or virus-free seedlings.