7 results about "Chlorosis" patented technology

The present application relates to the technical field of citrus cultivation, and particularly relates to application of a green transition peptide in relieving iron deficiency chlorosis of citrus leaves, and application of the green transition peptide in a product for relieving iron deficiency chlorosis of citrus leaves. An amino acid sequence of the green transition peptide is NTLISKVLNKGDAFVFPIGLIHFQFNIGK. The green transition peptide is applied to promote absorption and transport of iron elements by citrus plants, the green transition peptide and EDDHA-iron can play a synergistic effect, relieve iron deficiency chlorosis of citrus, increase iron content and chlorophyll content of leaves, improve photosynthetic rate, increase fruit content, and improve fruit quality.

The invention belongs to the technical field of biological genetic engineering, and particularly relates to a corn kernel development regulation gene ZmPPR299, an encoding protein thereof, an SNP (Single Nucleotide Polymorphism) site, a molecular marker and application of the molecular marker, the gene ZmPPR299 is located in a corn chromosome 5, and functional verification shows that the gene encodes a PPR protein located in chloroplast, and the molecular marker can be used for regulating the development of corn kernels. The chloroplast gene is an essential gene for regulating corn kernel development and chloroplast functions; the mutation of the gene can cause the lagging of embryo and endosperm development, the reduction of basal transfer layer cell proliferation, and the insufficient filling of starch grains and protein bodies, and finally, the results show that the grains shrink, the hundred-grain weight is obviously reduced, and the leaves of seedlings lose green. The invention also develops a specific CAPS molecular marker and a detection primer thereof based on a single base mutation site of the gene, and the genotype of the mutant can be rapidly and accurately identified. The gene resource and the molecular marker provided by the invention have important application values in analysis of a corn kernel development regulation network, development of molecular assisted breeding and creation of high-yield and high-quality new corn germplasm.

Disclosed is the application of humic acid in improving the phytoremediation effect of heavy metals in water, and relates to the technical field of environmental ecological engineering. The invention discloses the application of humic acid in improving the phytoremediation effect of heavy metals in water, wherein the phytoremediation of heavy metals is to reduce the content of heavy metals in water by planting Vallisneria chinensis. Adding humic acid can slow down the chlorosis of Vallisneria vallissima leaves under heavy metal poisoning and increase the accumulation of heavy metals in Vallisneria vallissima leaves and roots. At the same time, it can also reduce the leaching ability of heavy metals in water, enhance the enzyme activities related to active oxygen metabolism in plants by stimulating the synthesis of protein and enzymes in various organs of plants, reduce the MDA concentration in plants, adjust the active oxygen content in plants, reduce the degree of membrane lipid peroxidation and enhance the resistance of plants to heavy metals.

The invention relates to the technical field of agricultural biology, in particular to a rice ACCase mutant gene D2291E and application thereof. The invention provides a rice ACCase mutant gene D2291E. According to the rice ACCase mutant gene D2291E, the nucleotide sequence of a wild rice ACCase gene is mutated at the 6873 site. The substance containing the mutant gene provided by the invention has excellent resistance to acetyl-coenzyme A inhibitor herbicides. The mutant gene is transferred into wild rice, so that the wild rice has resistance to acetyl-coenzyme A inhibitor herbicides, and a field spraying result in the three-leaf stage of the rice shows that the mutant rice containing the mutant gene can still keep normal growth and development when the concentration of the thiacloprid is more than 4 times that of the thiacloprid; the maturing rate and the growth period are not influenced, but the wild type plant is only 1-time in concentration, i.e., the plant is green and yellow and gradually withered after 5 days until the whole plant is dead.

The invention relates to a composition with an insecticidal effect, a pesticide and application thereof, and belongs to the technical field of pest control. The composition disclosed by the invention can be used for effectively preventing and treating piercing-sucking mouthpart pests such as aleyrodid and green peach aphid. According to verification of the embodiment of the invention, in a field pesticide effect test on tomato bemisia tabaci, the control effect of the composition disclosed by the invention is as high as 93.45% after the composition is applied for 10 days; meanwhile, in the prevention and treatment of peach aphids, under the same dosage, the prevention effect after 14 days can still be maintained at a high level of 90.78%. It is fully proved that the composition is good in fast-acting property and outstanding in persistence, and recovery and rerampant of pest populations can be effectively controlled. Moreover, the composition disclosed by the invention is safe to the growth of test crops such as tomatoes and peach trees, no phytotoxicity symptoms such as dwarfing, chlorosis and malformation are observed after the composition is applied, and the composition shows good crop compatibility.

The invention discloses a method for detecting herbicide tolerance of transgenic sugarcane, and belongs to the field of detection of target traits and functional efficiency of biological breeding products. The detection method comprises the following steps: spraying a herbicide in a 4-5 leaf stage of transgenic sugarcane, spraying the herbicide in stem leaves, randomly investigating 20 plants in each plot, and determining the herbicide tolerance of the herbicide-resistant sugarcane by investigating the symptoms of phytotoxicity. The phytotoxicity symptoms comprise growth inhibition, chlorosis, blight and deformity. The method can accurately reflect the herbicide tolerance of the herbicide-resistant sugarcane in the current growth period, does not need complex detection steps, improves the detection method, and is beneficial to promoting the industrialization process of transgenic sugarcane biological breeding.

This invention belongs to the field of rapid detection of plant viruses, specifically the rapid detection of sweet potato chlorosis dwarf virus (SPCSV). It proposes an RPA primer set and probe, a reagent kit, and a method of use for detecting SPCSV. This patent is applicable to the rapid detection of SPCSV virus. One sample undergoes one RPA test reaction using a single LFD test strip to directly read the result. The experimental method is simple, rapid, and highly efficient, requiring no additional instruments, placing no restrictions on operators, and allowing the experiment to be conducted not only in the laboratory but also in the field. Alternatively, multiple samples can undergo multiple RPA tests, with results displayed via agarose gel electrophoresis. This reduces experimental costs and makes it more suitable for laboratory testing of suspected infected plants or virus-free seedlings.