Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

181 results about "Ophthalmological disorder" patented technology

Systems and methods for tele-ophthalmology

InactiveUS20020052551A1Easy to optimizeSimple and accessible and economicalDiagnostic recording/measuringMedical imagesOPHTHALMOLOGICALSServer
The present invention provides systems and methods for screening and tracking ophthalmic disease in a plurality of patients. The invention includes a screening subsystem comprising a non-mydriatic camera for obtaining digital images of eyes of the patients, a central database for storing the digital images of the eyes of patients as well as patient demographic data and related health data, and a central server comprising a computer which executes retinopathy grading algorithms, wherein the retinopathy grading algorithms recognize and assign a grade to ophthalmic disease present in the digital eye image and store the results in the central database. The invention also provides a method for screening and tracking ophthalmic disease in a patient with the steps of obtaining digital images of eyes of the patient by means of a screening subsystem comprising a camera, transmitting the obtained digital image to a central database and to a central server, executing retinopathy grading algorithms that recognize and assign a grade to ophthalmic disease present in the digital eye images, and storing the transmitted digital images and the results of the retinopathy grading algorithms in the central database.
Owner:VIMETRICS

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Ophthalmic formulations and uses thereof

ActiveUS20060183698A1RestoringBiocideSenses disorderDiseaseSerum electrolytes
Provided by the present invention are compositions or formulations suitable for application to a patient's eyes which utilizes a topical ophthalmically-acceptable formulation comprising a therapeutically-effective amount of an ophthalmically-active antimicrobial agent, and an ophthalmically-active anti-inflammatory or steroidal agent in combination with physiologic levels of serum electrolytes in an ophthalmic formulation for the treatment of changes in the normal eye condition. The invention also includes methods of treating patient's having an ophthalmic disease, injury or disorder, utilizing the compositions or formulations. Also provided are kits comprising the compositions or formulations and a means of applying the compositions or formulation to the patient's eyes.
Owner:BAUSCH & LOMB INC

Systems and methods using weighted-ensemble supervised-learning for automatic detection of ophthalmic disease from images

Disclosed herein are systems, methods, and devices for classifying ophthalmic images according to disease type, state, and stage. The disclosed invention details systems, methods, and devices to perform the aforementioned classification based on weighted-linkage of an ensemble of machine learning models. In some parts, each model is trained on a training data set and tested on a test dataset. In other parts, the models are ranked based on classification performance, and model weights are assigned based on model rank. To classify an ophthalmic image, that image is presented to each model of the ensemble for classification, yielding a probabilistic classification score—of each model. Using the model weights, a weighted-average of the individual model-generated probabilistic scores is computed and used for the classification.
Owner:RETINA AI HEALTH INC

Management of ophthalmologic disorders, including macular degeneration

InactiveUS20060069078A1A2E production can be reducedInhibit bindingBiocideSenses disorderDiseaseRod Photoreceptor Cells
A drug may be used in the preparation of a medicament for the treatment or prevention of an ophthalmologic disorder, wherein the drug inihibits, antagonizes, or short-circuits the visual cycle at a step of the visual cycle that occurs outside a disc of a rod photoreceptor cell.
Owner:PRESIDENT & FELLOWS OF HARVARD COLLEGE

Apparatus and method for diagnosis of optically identifiable ophthalmic conditions

An apparatus that measures images of at least a portion of an eye and records data sets indicative of a neurological condition. A method of the invention employs a plurality of images, or a plurality of data sets, or at least one image and at least one data set to provide an interpretive result based on the interrelation of the images and data sets, such as by superposition. The apparatus and method thereby provide guidance as to the presence of a medical condition in a patient. The apparatus includes modules that observe images and / or data sets, that analyze the information, and that superpose the information. Modules are provided to store information, to provide data output, to provide reports, and to display information, including superposed images and data. Modules can be provided in hardware, in software, in firmware, or in combinations thereof.
Owner:WELCH ALLYN INC

Applications of exosome from mesenchymal stem cells

The invention relates to applications of exosome from mesenchymal stem cells. The concrete applications are applications of exosome from mesenchymal stem cells in preparation of medicines treating ophthalmic diseases. The ophthalmic diseases comprise uveitis, retinal detachment, retinal degeneration, retinal damage caused by various reasons and inflammation. Experiments prove that exosome has nerve nourishing and immunosuppression functions, can relief retina damage caused by various reasons and can reduce inflammatory reactions, therefore retina functions are improved, and a new approach is provided for clinic treatment of ophthalmic diseases.
Owner:天津医科大学眼科医院

Treatment of conditions associated with the presence of macromolecular aggregates, particularly ophthalmic disorders

A method and formulation are provided for the treatment of medical conditions associated with the formation and / or deposition of macromolecular aggregates, particularly those associated with adverse ocular conditions. The formulation contains a non-cytotoxic chelating agent containing at least three negatively charged chelating atoms and a charge-masking agent containing at least one polar group and having a molecular weight of less than about 250, wherein the polar group contains at least one and preferably at least two heteroatoms having a Pauling electronegativity greater than about 3.00, and further wherein the molar ratio of the charge-masking agent to the chelating agent is sufficient to ensure that substantially all negatively charged chelating atoms are associated with a heteroatom on the charge-masking agent.
Owner:LIVIONEX

Treatment of ophthalmic conditions

Ophthalmic conditions such as presbyopia, myopia, and astigmatism can be corrected by the use of a molding contact lens in combination with a pharmaceutical composition suitable for delivery to the eye. The molding contact lenses are preferably commercially available and are not specifically designed for orthokeratology. The agents in the pharmaceutical compositions such as hyaluronase allow the cornea of the eye to be molded in order to correct the refractive error of the eye. The contact lenses and the pharmaceutical composition induce a change in the radius of curvature of the anterior surface of the cornea, thereby correcting the refractive error of the eye. One advantage of the inventive technique is that the patient with his or her own individual visual needs guides the treatment until the patient near and far visual needs are met. The present invention also provides for kits, which contain molding contact lenses, pharmaceutical composition suitable for delivery to the eye, and instructions, useful in the inventive system.
Owner:OSIO

Pharmaceutical Compositions and Method for Treating Dry Eye

A composition for treating or reducing a dry eye condition or an ophthalmological disorder that has an etiology in inflammation comprises a dissociated glucocorticoid receptor agonist (“DIGRA”). The composition can be formulated for topical application, injection, or implantation.
Owner:BAUSCH & LOMB INC

Organic nitric oxide enhancing salts of angiotensin ii antagonists, compositions and methods of use

InactiveUS20090215838A1Improve propertiesBiocideSenses disorderOrganic nitratesRenovascular disease
The invention describes compositions and kits comprising at least one organic nitric oxide enhancing salt of an angiotensin π antagonist, and, optionally, at least one nitric oxide enhancing compound and / or at least one therapeutic agent. The invention also provides methods for (a) treating cardiovascular diseases; (b) treating renovascular diseases; (c) treating diabetes; (d) treating diseases resulting from oxidative stress; (e) treating endothelial dysfunctions; (f) treating diseases caused by endothelial dysfunctions; (g) treating cirrhosis; (h) treating pre-eclampsia; (j) treating osteoporosis; (k) treating nephropathy; (l) treating peripheral vascular diseases; (m) treating portal hypertension; (n) treating ophthalmic disorders; (o) treating metabolic syndrome; and (p) treating hyperlipidemia. The organic nitric oxide enhancing compounds that form salts with the angiotensin II antagonists are organic nitrates, organic nitrites, nitrosothiols, thionitrites, thionitrates, NONOates, heterocyclic nitric oxide donors and / or nitroxides. The heterocyclic nitric oxide donors are furoxans, sydnonimines, oxatriazole-5-ones and / or oxatriazole-5-imines.
Owner:NICOX SA

Compositions Comprising an Anti-PDGF Aptamer and a VEGF Antagonist

The present invention is directed to compositions comprising an anti-PDGF aptamer and a VEGF antagonist. In certain embodiments, the compositions of the invention are useful for treating or preventing an ophthalmological disease.
Owner:OPHTHOTECH CORP

Method and System for Low Coherence Interferometry

Optical Coherence Tomography (OCT) system and apparatus of this instant application is very useful for diagnosis and management of ophthalmic diseases such as retinal diseases and glaucoma etc. Instant innovative OCT diagnostic system leverages advancements in cross technological platforms. The Michelson interferometric system presented in this application could be used for the OCT imaging, which includes biological OCT imaging, medical OCT imaging, ophthalmic OCT imaging, corneal OCT imaging, retinal OCT imaging, and the like. A tunable filter is placed in front of the detector to make the interferometer more sensitive and accurate for examining various samples for diagnosis.
Owner:NETRA SYST

Multifunctional Ophthalmic Compositions

InactiveUS20090239836A1Improved multifunctional ophthalmic compositionSimple compositionAntibacterial agentsBiocideSolubilityOxygen
An multifunctional ophthalmic composition includes a nonionic oxygen-containing polymer and a surfactant. The composition can be used to treat or control ophthalmic diseases, conditions, or disorders. The composition can be a drug delivery vehicle for medicaments having low solubility in water.
Owner:BAUSCH & LOMB INC

Non-peptide somatostatin receptor ligands

Non-peptide somatostatin receptor ligands with conformationally restricted side chains exhibiting high binding affinity toward somatostatin receptors are provided. The compounds exhibit a high selectivity and act as agonists at human subtype 2 somatostatin receptors. The compounds are long acting for advantageous use as medicaments in peripheral diseases where somatostatinergic therapy is indicated. Furthermore, many of the compounds are lipophilic and are particularly useful for treating central nervous system and ophthalmic diseases where penetration of the blood brain and blood retinal barriers is required. It is a further object to describe the preferred stereoisomers of these somatostatin agonists and processes for their preparation. Further objects will become apparent from reading the following description.
Owner:SHAPIRO GIDEON +3

Substituted tetracyclic 1h-indeno [1,2-b]pyridine-2(5H)-one analogs thereof and uses thereof

Provided herein are tetracyclic 1H-indeno[1,2-b]pyridine-2(5H)-one analogs and derivatives, compositions comprising an effective amount of a tetracyclic 1H-indeno[1,2-b]pyridine-2(5H)-one analog and / or derivative and methods for treating or preventing an inflammatory disease, a reperfusion injury, diabetes mellitus, a diabetic complication, a reoxygenation injury resulting from organ transplantation, an ischemic condition, a neurodegenerative disease, renal failure, a vascular disease, a cardiovascular disease, an ocular or opthalmologic disease, cancer, a complication of prematurity, cardiomyopathy, retinopathy, nephropathy, contrast induced nephropathy, neuropathy, erectile dysfunction or urinary incontinence, comprising administering to a subject in need thereof an effective amount of a tetracyclic 1H-indeno[1,2-b]pyridine-2(5H)-one analog or derivative.
Owner:INOTECK PHARMA CORP

Use of PEDF in an Encapsulated Cell-Based Delivery System

InactiveUS20110111008A1Inhibiting neuralInhibiting retinal degradationBiocideSenses disorderDiseasePIGMENT EPITHELIUM-DERIVED FACTOR
The invention relates to a device for delivery of pigment epithelium derived factor (PEDF) to the eye utilizing encapsulated PEDF-secreting cells and related methods for the treatment and prevention of ophthalmic diseases and disorders.
Owner:NEUROTECH USA

Treatment of ophthalmic conditions

Ophthalmic conditions such as presbyopia, myopia, and astigmatism can be corrected by the use of a molding contact lens in combination with a pharmaceutical composition suitable for delivery to the eye. The molding contact lenses are preferably commercially available and are not specifically designed for orthokeratology. The agents in the pharmaceutical compositions such as hyaluronase allow the cornea of the eye to be molded in order to correct the refractive error of the eye. The contact lenses and the pharmaceutical composition induce a change in the radius of curvature of the anterior surface of the cornea, thereby correcting the refractive error of the eye. One advantage of the inventive technique is that the patient with his or her own individual visual needs guides the treatment until the patient near and far visual needs are met. The present invention also provides for kits, which contain molding contact lenses, pharmaceutical composition suitable for delivery to the eye, and instructions, useful in the inventive system.
Owner:OSIO

Frequency domain OCT based whole-eye imaging and parameter measuring method and system

PendingCN111297319AWide range zoomQuick focusOthalmoscopesChoroid membraneRetina
The invention discloses a frequency domain OCT based whole-eye imaging and parameter measuring method and system. The whole-eye imaging and parameter measuring system includes a ranging system and a target system; through the conversion of anterior segment-posterior segment measurement, a lens can move to change the distances to the front of the eyes; and the measuring system can measure the boundary distance of each segment in anterior segments and posterior segments, and includes the measurement calculating on ocular axial lengths and anterior and posterior mean cornea and the identificationcalculating on central corneal thicknesses, lens thicknesses, anterior chamber depths and total thicknesses of the anterior segments even on the thicknesses of retina and choroid. Compared with traditional instruments which can only perform imaging on the anterior segments or the posterior segments, the system can combine the imaging of the anterior segments and the posterior segments at a lowercost, so that the imaging and parameter measuring of whole eyes can be realized, and therefore, the measuring system and method have great advantages on the investigation of ophthalmic diseases and the location of eye diseases.
Owner:FOSHAN UNIVERSITY

Cardiovascular Compounds Comprising Nitric Oxide Enhancing Groups, Compositions and Methods of Use

InactiveUS20090012057A1Improve propertiesBiocideSenses disorderRenovascular diseaseNitric oxide
The invention describes compositions and kits comprising at least one cardiovascular compound comprising at least one nitric oxide enhancing group, or pharmaceutically acceptable salts thereof, and, optionally, at least one nitric oxide enhancing compound and / or at least one therapeutic agent. The invention also provides methods for (a) treating cardiovascular diseases; (b) treating renovascular diseases; (c) treating diabetes; (d) treating diseases resulting from oxidative stress; (e) treating endothelial dysfunctions; (f) treating diseases caused by endothelial dysfunctions; (g) treating cirrhosis; (h) treating pre-eclampsia; Q) treating osteoporosis; (k) treating nephropathy; (l) treating peripheral vascular diseases; (m) treating portal hypertension; (n) treating ophthalmic disorders; (o) treating metabolic syndrome; and (p) treating hyperlipidemia. The cardiovascular compounds are angiotensin II antagonists, aldosterone antagonists, endothelin antagonists, hydralazine compounds, neutral endopeptidase inhibitors and renin inhibitors. The nitric oxide enhancing groups are nitroxides and / or heterocyclic nitric oxide donors.
Owner:NICOX SA

Method of treating conditiions with kinase inhibitors

The present invention relates to a method of treating ophthalmic diseases and conditions, e.g. diabetic retinopathy, age-related macular degeneration, retinopathy of prematurity, etc., in a subject comprising administering to said subject a therapeutically effective amount of at least one compound of formula Ior a prodrug, pharmaceutically acceptable salt, racemic mixtures or enantiomers of said compound. The compounds of formula I are capable of modulating tyrosine kinase signal transduction in order to regulate, modulate and / or inhibit abnormal cell proliferation.
Owner:ALLERGAN INC

Knowledge data and artificial intelligence driven ophthalmology multi-disease identification system

The invention provides a target classification system. The target classification system can specifically be a knowledge data and artificial intelligence driven multi-disease identification system. The system can be used for: acquiring medical images and non-image medical information; using a medical expert knowledge base for matching information data, and obtaining an ophthalmic disease weight result through a medical knowledge reasoning algorithm; obtaining an ophthalmic disease weight result by using an organ tissue segmentation algorithm and a disease focus recognition algorithm in medical image diagnosis; obtaining weight results by combining knowledge reasoning and medical image recognition, and obtaining a final disease diagnosis result through weighted calculation. According to a medical clinical diagnosis thought, structured processing is carried out on medical data through big data, and automatic diagnosis of diseases is realized through the detection capability of an artificial intelligence model on disease focuses. The system improves the existing doctor seeing mode, realizes artificial intelligence preliminary diagnosis and screening of diseases, effectively relieves the current situation of shortage of medical resources, and has a wide application prospect.
Owner:XIAMEN UNIV

Adjustable ophthalmic disease examination auxiliary frame

The invention discloses an adjustable ophthalmic disease examination auxiliary frame, and relates to the technical field of ophthalmic disease auxiliary instruments. The adjustable ophthalmic diseaseexamination auxiliary frame comprises a supporting plate, wherein a supporting frame is fixedly connected to the top of the supporting plate, vertical adjusting assemblies are symmetrically and fixedly installed on the two sides of the top of the supporting frame, eye opening devices are fixedly installed at the bottom ends of the vertical adjusting assemblies through first electric telescopic rods, each eye opening device comprises a first fixing block, and first eye attaching pieces are fixedly connected to the bottoms of the first fixing blocks through connecting blocks. According to the adjustable ophthalmic disease examination auxiliary frame, the eye opening devices are arranged to be matched with reverse adjusting assemblies and second electric telescopic rods, the upper eyelid andthe lower eyelid of a detected person can be opened, the eyelids are prevented from being continuously closed, and a doctor can conveniently observe the eyes; and the positions of the eye opening devices can be adjusted by arranging the vertical adjusting assemblies and transverse adjusting assemblies, and therefore the adjustable ophthalmic disease examination auxiliary frame can adapt to the eyepositions of different detected persons, and is more convenient and flexible to use.
Owner:YANTAI YUHUANGDING HOSPITAL

Application of carnosic acid in preparing medicament for suppressing angiogenesis

The invention relates to application of carnosic acid in preparing a medicament for suppressing angiogenesis. The invention has the advantages that: the novel application of the carnosic acid discovers the effect of the carnosic acid in resisting angiogenesis for the first time, and the carnosic acid can effectively suppress proliferation, migration and canaliculization of vascular endothelial cells for the first time, which proves that the carnosic acid has the activity of resisting the angiogenesis, can be used as an angiogenesis suppressant, and can be applied to preparation of angiogenesis medicaments as the angiogenesis suppressant to treat neovascularization dependent and neovascularization related diseases, such as tumors, arthritis, psoriasis, ocular diseases, atherosclerosis, and the like.
Owner:SHANGHAI JIAOTONG UNIV SCHOOL OF MEDICINE

Light-driven oxygen production type corneal contact lens, preparation method and application thereof

ActiveCN110989201AAdjust absorption characteristicsImprove light utilizationOptical partsHeterojunctionUltraviolet lights
The invention discloses a light-driven oxygen production type corneal contact lens, a preparation method and application thereof, and belongs to the technical field of corneal contact lenses. The light-driven oxygen production type corneal contact lens is composed of a flexible heterojunction photocatalytic electrode and a silicon-based hydrogel matrix. The preparation method includes: firstly, sputtering a p-type semiconductor and an n-type semiconductor to two faces of a flexible center interlayer through a magnetron sputtering method to prepare the flexible heterojunction photocatalytic electrode, then coating the flexible heterojunction photocatalytic electrode with a passivation layer and performing packaging into the silicon-based hydrogel matrix, and conducting machining and formingto obtain the light-driven oxygen generation type corneal contact lens. According to the invention, the oxygen supply mode that the traditional corneal contact lens carries oxygen with water or allows oxygen to permeate through a channel is changed into a self-oxygen-production oxygen supply mode, so that the wearing comfort and durability of the corneal contact lens are improved. The light-driven oxygen generation type corneal contact lens can absorb harmful light (ultraviolet light) or strong light (blue light and laser) to protect eyes; and the generated high active oxygen, hydrogen and the like have prevention and treatment effects on ophthalmic diseases (keratitis, conjunctivitis and glaucoma) caused by bacteria and viruses.
Owner:JINLING INST OF TECH

Ophthalmic therapy device

ActiveCN104856799AOvercome the defects of high temperature deformationPromote combustionDevices for heating/cooling reflex pointsElectrotherapyNasal bridgeOPHTHALMOLOGICALS
The invention discloses an ophthalmic therapy device. The ophthalmic therapy device comprises a periscope shell, wherein a plurality of convection holes are formed in the shell; an eyelet cushion is arranged on the open end at the reverse side of the shell, and porous lenses communicated with the inner part of the shell are arranged on left and right parts of the eyelet cushion; a nose bridge cushion is arranged between left and right porous lenses, left and right smoke discharging columns are arranged at the upper end of the shell, smoke discharging holes are formed in the tops of the left and right smoke discharging columns, smoke discharging caps are sleeved on the left and right smoke discharging columns, left and right ash outlets are formed at the lower end of the shell, ash receiving slots are formed in the shell, and moxibustion cone fixing tables for placing moxibustion cones are erected in the left and right ash receiving slots. The ophthalmic therapy device has a certain effect to relief and treat ophthalmic diseases such as amblyopia, shortsightedness, hyperopia and strabismus in young children and senior cataracts.
Owner:连云港市一明医疗科技有限公司