Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

29 results about "SOX2" patented technology

SRY (sex determining region Y)-box 2, also known as SOX2, is a transcription factor that is essential for maintaining self-renewal, or pluripotency, of undifferentiated embryonic stem cells. Sox2 has a critical role in maintenance of embryonic and neural stem cells.

Biomarker for accurate typing of esophageal squamous carcinoma lesion and application of biomarker

The invention discloses a biomarker for accurate typing of esophageal squamous carcinoma lesion and application of the biomarker, and belongs to the technical field of molecular biology, the biomarker is SOX2 protein and KDM4B protein which are co-localized in nuclei, and the biomarker is applied to accurate typing of esophageal squamous carcinoma lesion with a non-diagnostic purpose. The cell proportion and distribution conditions of the SOX2 protein and the KDM4B protein are simultaneously displayed on the same section by adopting a double-label immunofluorescence method, and tests prove that the intranuclear co-localization of the SOX2 and the KDM4B can be used as an early warning mark and is used for identifying high-risk patients or early stages of precancerous lesions or distinguishing tumor patients, so that the missed diagnosis rate is reduced, and the diagnosis time is shortened. Therefore, a reliable basis is provided for accurate typing of esophageal squamous carcinoma lesions.
Owner:SICHUAN CANCER HOSPITAL

Polypeptide in targeted combination with SOX2 protein and application thereof

The invention relates to the technical field of biological medicine, and relates to a polypeptide in targeted combination with SOX2 protein and application thereof, the polypeptide has an amino acid sequence as shown in SEQ ID NO.1, or has at least 85%, 90%, 95% or more than 99% of sequence identity with the amino acid sequence; the polypeptide inhibits phase separation of SOX2, liquid drops formed by phase separation of SOX2 can be avoided, then the situation that the liquid drops wrap chemotherapeutic drugs, influence the curative effect of the chemotherapeutic drugs and cause tolerance of tumor cells to the chemotherapeutic drugs is avoided, and the polypeptide does not influence the transcription activation function of SOX2 serving as a transcription factor; the polypeptide can inhibit the phase separation of the SOX2, so that the regulation of normal physiological functions, such as high expression in organs such as eyes of a human body, of the SOX2 as a transcription factor is not influenced, and therefore, the polypeptide disclosed by the invention can reverse chemotherapy drug resistance of tumors such as squamous carcinoma by inhibiting the phase separation of the SOX2, can be used for adjuvant therapy of the tumors such as squamous carcinoma, and has no obvious toxic or side effect on each organ of an organism.
Owner:GUANGZHOU NAT LAB

Cell drug and preparation method thereof

The invention relates to the technical field of cell preparation, and particularly discloses a cell drug and a preparation method thereof.The cell drug comprises mesenchymal cells and pharmaceutically acceptable auxiliary materials; the mesenchymal cell is characterized in that the expression of SOX2, DPPA4 and MYCN genes is negative; the auxiliary material comprises a sodium chloride solution containing albumin; the concentration of the sodium chloride solution is 0.1%-2%; the content of the albumin in the sodium chloride solution is 0.1%-10%. The cell medicine is simple in composition and good in auxiliary material compatibility, the motility of active ingredients can be protected, and the safety and reliability of the cell medicine are remarkably improved by optimizing the preparation process.
Owner:TASLY STEM CELL BIOLOGY LAB TASLY GRP LTD

Efficient and non-genetically modified iPSC-induced, industrialized single clone selection platform, and use

Disclosed is an efficient and non-genetically modified iPSC-induced, industrialized single clone selection platform, and a use. The platform can efficiently perform reprogramming, and only requires the use of a minimal number of reprogramming factors (OCT4, SOX2, E6, E7). During the single clone separation stage of the present invention, SSEA4 / TRA-1-60 is used as a screening marker, and a large number of single cell clones are obtained by means of flow cytometry. The platform described in the present invention has advantages such as high reprogramming efficiency, high safety, easy operation, and large-scale production.
Owner:ALLIFE MEDICINE (ZHUHAI) LTD

A composition and use thereof for regenerating retinal ganglion cells by utilizing endogenous microglia

ActiveCN120093951BSenses disorderNervous disorderRetinal ganglionReprogramming
The application discloses a kind of compositions and applications for regenerating retinal ganglion cells by using endogenous microglia.The present application finds that multiple genes (Brn3b, Sox2, Cbln1 and NP1, referred to as BSCN) can be expressed in microglia to transform into retinal ganglion cells by in vivo microglia fate lineage tracking.The regenerated ganglion cells project axons to the distant brain, rebuild visual neural circuit and restore impaired vision in adult glaucoma mice.In addition, the regenerated ganglion cells can stably survive for up to one year, and the same regeneration strategy is used in old glaucoma mice, which confirms the effectiveness of BSCN reprogramming to regenerate RGCs.Therefore, the present application determines that microglia is a new type of reprogramming seed cell, and finds that four key genes are involved in RGCs regeneration to restore vision, which provides a new therapeutic drug and means for the treatment of glaucoma and related diseases.
Owner:SHANGHAI CITY PUDONG NEW DISTRICT ZHOUPU HOSPITAL

Composition for preventing or treating cisplatin-resistant cancer comprising DUSP23 expression or activity inhibitor as an active ingredient

PendingKR1020260115834ASOX2Inducer Cells
The present invention relates to a composition for the prevention or treatment of cisplatin-resistant cancer comprising an inhibitor of DUSP23 expression or activity as an active ingredient. It was found that DUSP23 expression is upregulated in cell clusters exhibiting characteristics of cancer stem cells, and that knocking down DUSP23 significantly reduces cell cluster formation as well as decreases the expression of SOX2, a major stem cell marker. Furthermore, DUSP23 expression was increased in lung cancer cells that had developed cisplatin resistance, and it was confirmed that the downregulation of DUSP23 inhibits self-renewal and invasive capabilities during the induction of cancer cell death. In addition, it was confirmed that DUSP23 plays an important role in promoting cancer stem cell characteristics through SOX2 expression. In conclusion, it has been shown that targeting DUSP23 can be a promising therapeutic strategy to overcome anticancer drug resistance in lung cancer, and the composition of the present invention is expected to be usefully utilized as a treatment for lung cancer cells with cisplatin resistance.
Owner:CHUNG ANG UNIV IND ACADEMIC COOP FOUND

Culture medium for goat trophoblast organoid, culture method and application

The invention discloses a culture medium for goat trophoblast organoid, a culture method and application, and belongs to the field of goat trophoblast organoid culture. The method comprises the following steps: separating trophoblast tissues from a healthy goat placenta which is pregnant for 80-90 days, digesting the trophoblast tissues through type II collagenase to obtain primary cells, compounding the primary cells with matrigel, and performing three-dimensional culture in an improved trophoblast organ culture medium with specific components to form mature organs. The organ is of a typical three-dimensional structure, and KRT23 and SOX2 markers are stably expressed. The organoid culture system based on the goat primary trophoblast cells is established for the first time, gene modification is not needed, the in-vivo physiological status is highly simulated, and the culture system is standardized and good in repeatability. The constructed organoid can be used as an ideal in-vitro model for researching placenta development, evaluating drugs and toxins and modeling infectious diseases in the gestation period, and is of great significance in improving the reproductive research level of goats and the production benefits of animal husbandry.
Owner:SHANDONG AGRICULTURAL UNIVERSITY

Enhancing neuronal differentiation of ventral midbrain neural progenitor cells

The present invention relates to a method for directing differentiation of ventral midbrain NSCs into neurons comprising contacting a cell population comprising ventral midbrain NSCs with an inhibitor of MEK signaling and an inhibitor of NOTCH signaling, wherein the ventral midbrain NSCs co-express the markers FOXA2, LMX1A, EN1, OTX2, 5 and SOX2.
Owner:SOMITE THERAPEUTICS INC

Lineage Reprogramming to Induced Cardiac Progenitor Cells (iCPC) By Defined Factors

PendingUS20260193611A1SOX2Reprogramming
Animal cells, notably adult fibroblasts, are advantageously reprogrammed in direct lineage reprogramming methods using defined factors to produce proliferative and multipotent induced cardiac progenitor cells (iCPC). The iCPC thus produced can be differentiated under suitable differentiation conditions to cardiac lineage cells including cardiomyocytes, smooth muscle cells, and endothelial cells, as evidenced by expression of lineage specific markers. Sets of factors effective in combination to reprogram the fibroblasts can include a set that includes some or all of 5 factors (Mespl, Baf60c, Nkx2.5, Gata4, Tbx5), a set that includes some or all of 11 factors (Mespl, Mesp2, Gata4, Gata6, Baf60c, SRF, Isll, Nkx2.5, Irx4, Tbx5, Tbx20), a set that includes some or all of 18 factors (T, Mespl, Mesp2, Tbx5, Tbx20, Isll, Gata4, Gata6, Irx4, Nkx2.5, Handl, Hand2, Tbx20, Tbx18, Tip60, Baf60c, SRF, Hey2), and a set that includes some or all of 22 factors (T, Mespl, Mesp2, Tbx5, Tbx20, Isll, Gata4, Gata6, Irx4, Nkx2.5, Hand1, Hand2, Tbx20, Tbx18, Tip60, Baf60c, SRF, Hey2, Oct4, Klf4, Sox2, L-myc).
Owner:WISCONSIN ALUMNI RES FOUND

Differentiation and functional maturation of pancreatic islet tissue from pluripotent stem cells by ai-designed epigenetic modifiers

Methods are provided for generating pancreatic endocrine cells from pluripotent stem cells (PSCs) using epigenetic modifiers. A fusion protein comprising catalytically inactivated Cas9 (dCas9) and an embryonic ectoderm development (EED)-binding domain (EBdCas9) is used with guide RNAs (gRNAs) to target regulatory regions of transcriptional regulators including EOMES, PDX1, and NGN3. Sequential targeting of PDX1 and NGN3 promoters with EBdCas9 removes repressive H3K27me3 marks, increases activating H3K27ac modifications, and accelerates differentiation into insulin-producing β-cells. The methods significantly increase β-cell yields (~4-6 fold), reduce non-pancreatic lineage contaminants (CDX2+, SOX2+, enteroendocrine cells), enhance mitochondrial function, and produce glucose-responsive cells with superior functional maturation in vivo. The epigenetic interventions enforce pancreatic developmental fates while activating NGN3-dependent transcriptional programs necessary for endocrine cell differentiation, insulin secretion, and metabolic maturation. Cells and compositions produced by these methods are also provided.
Owner:UNIV OF WASHINGTON +4

Application of H3K9me2 as target spot in preparation of preparation for inducing differentiation of stem cells to gametes in vitro

PendingCN121186373ABiological testingSOX2Meiosis
The invention discloses application of H3K9me2 as a target spot in preparation of a preparation for inducing stem cells to differentiate to gametes in vitro, and relates to the technical field of stem cell breeding in animal husbandry. An H3K9me2 inhibitor BIX01294 is adopted as a treating agent, and in-vivo treatment is performed on a pregnant mouse and in-vitro treatment is performed on gonad tissue of a female fetal mouse. The result shows that the BIX01294 treatment can cause the reduction of the expression level of H3K9me2, so that the expression levels of pluripotent genes Oct4, Sox2 and Dppa3 are increased, the accessibility of whole genome chromatin is obviously changed, and the meiosis start and meiosis process are blocked. The result shows that the H3K9me2 can influence the differentiation of the stem cells to the gametes and is beneficial to the generation of artificial gametes in the stem cell breeding process.
Owner:INNER MONGOLIA UNIVERSITY

Methods and compositions for selective generation of dopaminergic precursors

ActiveUS12534740B2Genetically modified cellsNervous system cellsSOX2Dopaminergic
The present invention provides methods of transdifferentiating a somatic cell, e.g., a fibroblast, to an induced dopaminergic precursor cell (iDP) in vitro. The methods include ectopically expressing genes of (1) one or both of Brn2 and Brn4, or a variant thereof, (2) Sox2, or a variant thereof, and (3) one or both of Foxa2 and Lmx1a, or a variant thereof, in the somatic cell, and methods for treating a neurodegenerative disease, such as Parkinson's disease, with the iDP.
Owner:TONGJI UNIV +1

Cow milk-derived stem cell and isolation and culture method therefor

Provided are a cow milk-derived stem cell, and an isolation and culture method therefor. The method comprises the following steps: (1) taking fresh cow milk, and isolating cells therefrom; (2) coating a culture dish with a matrix gel in advance, discarding the coating solution, then washing the culture dish with a washing solution, and discarding the washing solution; (3) inoculating the cells treated in the step (1) on the coated culture dish, and culturing the cells with a stem cell culture medium; and (4) when the cell confluence reaches 80% or more, digesting the cells with a digestion enzyme, terminating the digestion, isolating the cells, resuspending the cells using a CTFR culture solution, then inoculating the cells on a feeder layer for culture, promoting colony formation, and performing subculture to obtain cow milk-derived stem cells. The cow milk-derived stem cell has OCT4, SOX2, NANOG and SSEA4 markers.
Owner:BEIJING SANYUAN FOOD +1

Targeted expression of regeneration factors in aged / senescent cells

PCT designated stageWO2025208002A1VectorsAnimals/human peptidesPremature agingAge related disease
Provided are materials and methods for rejuvenating senescent cells. Senescent cells are transduced with a viral vector to express Oct4 and Sox2 proteins for partial cell reprogramming and / or to suppress a senescence-associated secretory phenotype. The materials and methods provided can be used to treat progeria syndrome, signs and symptoms of premature aging or natural aging or to rejuvenate tissue in subjects experiencing premature aging or having an agerelated disease.
Owner:ALTOS LABS INC

Microrna engineered vesicles to promote cell reprogramming

In multicellular organisms, complex secondary epigenetic regulatory systems are crucial for determining cell function and gene expression patterns across different organs and tissues, involving noncoding microRNAs (miRNAs), methylated DNA marks, and both methylated and acetylated histones. An intricate system of epigenetic gene regulation is not only fundamental to maintaining balanced and healthy cell function but also seems intrinsically linked to the functional decline observed during aging, environmental damage, and disease. The disclosed system uses prescribed sets of miRNA mimics and miRNA inhibitors that can stimulate the transient protein output of the OCT4, SOX2, and KLF4 protein transcription products. Each set of miRNAs is loaded into extracellular vesicles or nanocarrier vesicles to form nano bio-therapeutics that are designed to reprogram and rejuvenate aging tissues and organs. The therapeutical aim is to rejuvenate by reprogramming tissues and organs while minimizing the risks of cancer.
Owner:CENTAGEN INC

Induced pluripotent stem cell strain retaining NFIA gene deletion mutation and application of induced pluripotent stem cell strain

The invention belongs to the technical field of biological medicines, and discloses an induced pluripotent stem cell (iPSC) capable of retaining NFIA gene deletion mutation and application of the iPSC. The stem cell strain is preserved in the China Center for Type Culture Collection (the preservation number is CCTCC NO: C202590), carries NC000001.10: g.6165096761842967del heterozygous deletion mutation, contains deletion of exons 3-6 of an NFIA gene, stably expresses pluripotent markers (OCT4, SOX2, NANOG and SSEA4), and has the capability of differentiating to three germ layers. The preparation method comprises the following steps: separating PBMC (peripheral blood mononuclear cells) from peripheral blood of a patient, carrying out reprogramming by utilizing 2.0 Sendai Reprogam Kit, and amplifying pluripotent clone in Essental 8TMMedium. The stem cell strain can be used for constructing a research model of neurodevelopmental disorder diseases (such as corpus callosum insufficiency, hydrocephalus and development retardation), simulating pathological phenotypes by differentiating neurons, glial cells or brain organs, and is also suitable for drug screening and gene therapy research. And a precise humanized tool is provided for mechanism analysis and treatment development of NFIA deficiency related diseases.
Owner:NANJING CHILDRENS HOSPITAL

Lineage reprogramming to induced cardiac progenitor cells (iCPC) by defined factors

Animal cells, notably adult fibroblasts, are advantageously reprogrammed in direct lineage reprogramming methods using defined factors to produce proliferative and multipotent induced cardiac progenitor cells (iCPC). The iCPC thus produced can be differentiated under suitable differentiation conditions to cardiac lineage cells including cardiomyocytes, smooth muscle cells, and endothelial cells, as evidenced by expression of lineage specific markers. Sets of factors effective in combination to reprogram the fibroblasts can include a set that includes some or all of 5 factors (Mesp1, Baf60c, Nkx2.5, Gata4, Tbx5), a set that includes some or all of 11 factors (Mesp1, Mesp2, Gata4, Gata6, Baf60c, SRF, Isl1, Nkx2.5, Irx4, Tbx5, Tbx20), a set that includes some or all of 18 factors (T, Mesp1, Mesp2, Tbx5, Tbx20, Isl1, Gata4, Gata6, Irx4, Nkx2.5, Hand1, Hand2, Tbx20, Tbx18, Tip60, Baf60c, SRF, Hey2), and a set that includes some or all of 22 factors (T, Mesp1, Mesp2, Tbx5, Tbx20, Isl1, Gata4, Gata6, Irx4, Nkx2.5, Hand1, Hand2, Tbx20, Tbx18, Tip60, Baf60c, SRF, Hey2, Oct4, Klf4, Sox2, L-myc).
Owner:WISCONSIN ALUMNI RES FOUND

Efficient and safe fibroblast reprogramming method and system

The invention discloses an efficient and safe fibroblast reprogramming method and system, and belongs to the field of cell reprogramming. The method comprises the following steps: firstly, constructing a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) activation system, namely constructing dCAS-VPR fusion protein and designing sgRNA (Ribonucleic Acid) of a regulation region targeting OCT4 and SOX2 genes; secondly, introducing the system into somatic cells through an electroporation method; and finally, performing induction by adding chemical small molecule combinations in stages, including adding a histone deacetylase inhibitor and a TGF-beta pathway inhibitor into a culture medium in a stage I and adding a Wnt activator into a culture medium in a stage II, so as to finally obtain the induced pluripotent stem cells. According to the method, the reprogramming efficiency is improved by more than 20 times, the period is shortened to be within 16 days, the exogenous gene integration risk is completely avoided, and a safe and efficient solution is provided for individualized treatment.
Owner:HANGZHOU WUWEN QINGXIN ARTIFICIAL INTELLIGENCE BASIC TECHNOLOGY RESEARCH CO LTD

ABCB4 gene mutation-carrying induced pluripotent stem cell strain and application thereof

The invention belongs to the technical field of biological medicines, and particularly discloses an induced pluripotent stem cell (iPSC) strain carrying ABCB4 gene mutation and application thereof. The stem cell strain is preserved in the China Center for Type Culture Collection (the preservation number is CCTCC NO: C2025125), and carries ABCB4 gene composite heterozygous mutation c.992Ggt; a is (p.G331E), and c is 3152Tgt; the invention relates to the field of biomarkers (p.V1051A, C (p.V1051A), which can stably express pluripotent markers (OCT4, SOX2, NANOG and SSEA4), and has the capability of differentiating towards trigerm layers. The stem cell strain can be used for constructing a research model of progressive familial intrahepatic cholestasis type 3 (PFIC3), simulates disease phenotypes by differentiating hepatic cells or bile duct cells, is suitable for drug screening and gene therapy research, and provides a precise humanized tool for mechanism analysis and treatment development of ABCB4 mutation related diseases.
Owner:NANJING CHILDRENS HOSPITAL

DETECTION METHOD FOR HUMAN UMBILICAL CORD MESENCHYMAL STEM CELLS (hUC-MSCs)

The present invention relates to stem cell detection, and particularly relates to a detection method for human umbilical cord mesenchymal stem cells (hUC-MSCs). RNA of hUC-MSCs is extracted and reversely transcribed into cDNA, PCR amplification is conducted on the cDNA obtained to obtain an amplification product, and electrophoresis detection is conducted on the amplification product. Nucleic acid electrophoresis has the characteristics of high efficiency, high sensitivity and high resolution, therefore, in the present solution, the four genes of SSEA-4, NANOG, OCT-4 and SOX2 are detected by nucleic acid electrophoresis, which can be efficiently separated and detected according to different nucleic acid molecular sizes thereof in a short time.
Owner:SCLNOW BIOTECH CO LTD

A method for inducing mouse embryonic stem cells to transform into a totipotent state by using H2BC21 and application thereof

PendingCN122357455ACore geneLentivirus
This invention discloses a method for inducing mouse embryonic stem cells to transition to a pluripotent state using H2BC21 and its application, belonging to the fields of molecular biology and stem cell engineering technology. By constructing an interference vector targeting the H2BC21 gene, packaging it with lentivirus, and infecting mouse embryonic stem cells, the expression of the H2BC21 gene is knocked down, and embryonic stem cell lines with stable low expression of H2BC21 are obtained through screening. This invention is the first to discover that H2BC21 is a core negative regulator of mammalian embryonic stem cell pluripotency. After knocking down H2BC21, the expression of pluripotency core genes Nanog, Oct4, and Sox2 is downregulated, while the expression of pluripotency core genes Zscan4b, Usp17la, and Tmem92 is upregulated. The cells exhibit molecular characteristics similar to 2-cell phase cells, successfully achieving the transition from pluripotency to a pluripotent state.
Owner:INNER MONGOLIA UNIVERSITY

Polypeptide simulating Sox2 and application thereof

The invention discloses a polypeptide simulating Sox2 and application of the polypeptide, and belongs to the technical field of biological medicine, and the amino acid sequence of the polypeptide is GRKKRRQRRRPQGGSGHSGPQHPGLNAHGAAQMQPMHRY. According to the invention, the TAT-Sox2-EL-1 polypeptide capable of simulating the Sox2 function is successfully constructed, and in vitro, the polypeptide can be used for effectively reprogramming mouse spinal cord reactive astrocytes into motor neuron-like cells; and a new selectable way is provided for the medical research on cell replacement treatment and cell regeneration after SCI.
Owner:NANTONG UNIV

Complete-immunity lung squamous cell carcinoma animal model construction method, animal model and application

The invention belongs to the technical field of bioengineering, and relates to a complete immunity lung squamous cell carcinoma animal model construction method, an animal model and application, and the model construction method comprises the following steps: taking Trp53- / -lung cells, carrying out primary culture, and carrying out enzymolysis digestion to obtain single cells; the method comprises the following steps of: culturing a first organ, resuspending the first organ, and performing one of the following genetic modifications: I, knocking out Pten and Cdkn2a genes, and overexpressing Sox2 mutant genes and Myc genes; iI, knocking out Pten and Kmt2d genes, and carrying out overexpression on a Sox2 mutant gene and a Myc gene; iII, knocking out Pten and Kdm6a genes, and carrying out overexpression on a Sox2 mutant gene and a Myc gene; culturing the lung cells subjected to genetic modification to obtain second organs; and injecting the cell suspension into animal lung tissues, and culturing to obtain the lung squamous cell carcinoma animal model. Lung squamous cell carcinoma tissues of an animal model are extracted to prepare a single-cell suspension, and the single-cell suspension is injected into an animal lung of another to-be-constructed animal model. The lung squamous cell carcinoma tumor model can simulate the immunotherapy response of a patient, and is of great significance to the research of a lung squamous cell carcinoma treatment technology.
Owner:WEST CHINA HOSPITAL SICHUAN UNIV

A method to promote the dedifferentiation of satellite glial cells into neural stem cell-like cells

PendingCN122326531ANervonic acidSOX2
This invention relates to the field of cell dedifferentiation, and more particularly to a method for promoting the dedifferentiation of satellite glial cells into neural stem cell-like cells. First, a three-dimensional composite hydrogel of nervonic acid-modified chitosan is constructed. Then, satellite glial cells are seeded and cultured in this hydrogel, inducing dedifferentiation to obtain a cell population with a neural stem cell-like phenotype. The hydrogel constructs a basic network through covalently linked amide bonds between nervonic acid and chitosan, and utilizes the hydrophobic association domains formed by the long-chain alkyl groups of nervonic acid to self-assemble into a covalently cross-linked + hydrophobically associated dual network structure. This simulates the softness, deformability, and local mechanical gradient properties of the neural tissue microenvironment, providing ideal dedifferentiation conditions for satellite glial cells to differentiate into neural stem cell-like cells. During the dedifferentiation process, markers such as Nestin, SOX2, and PAX6 are expressed, showing promising applications in neural regeneration, disease model construction, and cell therapy.
Owner:FIRST AFFILIATED HOSPITAL OF KUNMING MEDICAL UNIV