35 results about "Cell replacement" patented technology

This utility model discloses a battery structure for easy cell replacement, including a top cover and several stacked side-opening support shells. The top cover covers the top of the stacked side-opening support shells. Each side-opening support shell consists of a cell protective ring shell and a bottom liquid cooling plate installed at the bottom of the cell protective ring shell. A cell replacement port is provided on one side of the cell protective ring shell. A cell heat-conducting support frame is provided at the bottom of the shell cavity of each side-opening support shell. The cell heat-conducting support frame extends to the outside of the cell protective ring shell through the cell replacement port and is equipped with a side hole baffle. A cell assembly is mounted on the cell heat-conducting support frame via a core frame. A notch-filling edging strip is installed on the top of the side hole baffle. A notch-filling edging strip is provided on the top of the outer side of the cell protective ring shell. The advantages are: through the side-pull structure and sliding components, the cells of the stacked battery packs can be quickly replaced without disassembling the upper stacked battery pack, making it convenient and practical.

This invention proposes a voltage allocation method for a dual-track standard cell library, comprising: a sensitivity-based coarse cell replacement, which calculates the replacement sensitivity of each cell based on its delay and power consumption, and replaces some high-voltage cells in the circuit with low-voltage cells in descending order of replacement sensitivity, resulting in a target chip where the estimated delay margin value for each path is the minimum positive value; and a path-based fine cell adjustment, which classifies each path and the cells in each path in the target chip, and then performs cell replacement adjustment, eliminating timing violations while further reducing the occurrence of low-voltage cells driving high-voltage cells, resulting in a target chip where the accurate delay margin value for each path is the minimum positive value, while minimizing circuit power consumption.

The utility model relates to the field of solar photovoltaic cells, and discloses a solar photovoltaic cell module connecting device, which comprises a single cell, a cell outer frame, a power supply module, an insulated wire, an electromagnet, a ferromagnetic component, a U-shaped fixing frame and a control unit, the electromagnet is mounted on one side of each battery outer frame and is connected to the power supply module; the ferromagnetic component is mounted on one side of the adjacent battery outer frame and is used for being matched with the electromagnet; the power supply module is used for providing a stable direct-current power supply for the electromagnet; the control unit is used for controlling opening and closing of the electromagnet; the insulated wire is used for connecting the power module, the electromagnet and the control unit; and the U-shaped fixing frame is used for fixing the electromagnet. According to the utility model, through the magnetic connection of the electromagnets and the ferromagnetic components, the convenient installation and disassembly of the battery monomers are realized, the firmness and the reliability of the connection are ensured, the replacement and the upgrading of the battery pieces are facilitated, the transportation cost is reduced, and the production efficiency and the maintenance convenience are improved.

The present invention relates to a system (1) which is developed for providing artificial intelligence and machine learning-aided cell change in beyond 5G and 6G mobile communication networks.

The invention provides a polypeptide simulating Ascl1 and application thereof, and relates to the technical field of biomedicine, and the technical key point is that the polypeptide simulating Ascl1 is provided, the polypeptide is a TAT-Ascl1-EL-1 polypeptide, and the sequence of the TAT-Ascl1-EL-1 polypeptide is as shown in SEQ ID: NO 01. According to the application, through a verification experiment, the TAT-Ascl1-EL-1 polypeptide is successfully screened out, and in vitro, the polypeptide can be used for effectively reprogramming rat spinal cord reactive astrocytes into neuron-like cells; and a new selectable way is provided for the medical research on cell replacement treatment and cell regeneration after SCI.

This utility model provides a functional battery cell tray quick-release structure, including an outer frame, inner linings, and two-color buckles. Two inner linings are symmetrically placed on the left and right sides inside the outer frame, each detachably connected to a row of two-color buckles. A left battery cell clamping cavity is formed between adjacent two-color buckles on the left inner lining, and a right battery cell clamping cavity is formed between adjacent two-color buckles on the right inner lining. The left and right battery cell clamping cavities respectively clamp the left and right ends of the battery cell. The two-color buckle includes a buckle frame, an outer soft rubber layer, and an inner soft rubber layer. The outer soft rubber layer is integrally disposed on the outside of the buckle frame, and the inner soft rubber layer is integrally disposed on the inside of the buckle frame. The outer and inner soft rubber layers are different colors, and a portion of the inner soft rubber layer extends towards the rear of the buckle frame to form a press handle. The use of detachable two-color buckles allows for compatibility with battery cells of different thicknesses by replacing the buckles. The press handle design enables quick cell replacement, minimizing labor costs and improving replacement efficiency.

The application provides a midbrain organoid and a preparation method and application thereof. The midbrain organoid is obtained in vitro by using pluripotent stem cells, can simulate the development and maturation rules of nerve cells in vivo, provides a solid foundation for later researches such as building a drug screening platform and modeling of diseases related to dopaminergic neurons, and opens up a new way for cell replacement therapy.

An ejector-type vacuum pump is described, said ejector-type vacuum pump being configured to accommodate two or more ejector cells, each of which two or more ejector cells is separately accessible and replaceable from the outside of the ejector-type vacuum pump. An ejector-cell can be replaced with a passive ejector-cell replacement insert, thereby allowing for facilitated modulation of the suction power. Also, modulation of the suction power can easily be accomplished by replacing an ejector cell with another ejector cell having different nozzle characteristics.

The purpose of this invention is to solve the problem that existing battery boxes use adhesive to fix battery cells and weld electrical connections, making it difficult to disassemble and replace the battery cells. This invention provides a battery box structure and method that facilitates battery cell replacement. The battery box structure includes a box body, battery cells, clips, sheet metal, connectors, and a power board. The box body has an internal cavity, and the battery cells are housed within it. The sheet metal is fixed inside the box body, and the clips engage with the sheet metal, with the upper end of the clips pressing down on the battery cells to achieve adhesive-free fixing. The connectors are made of conductive material and are located between the electrodes of adjacent battery cells. Each connector includes a cut section and connecting sections on both sides of the cut section, with the connecting sections on both sides fixedly connected to the corresponding electrodes of the two battery cells. The power board is used to electrically connect the two connecting sections after the cut section is removed. By using clips to fix the battery cells without adhesive, and in conjunction with the cuttable connectors, a detachable electrical connection is achieved, enabling rapid individual replacement of the battery cells.

The present invention discloses an immersion-type liquid-cooled energy storage system that facilitates the replacement of battery cells. The system comprises vertically extending columns and several shells, wherein the battery cells are arranged in the shells, a rotating shaft is fixedly connected to one side of the shells, the columns are provided with a rotating groove, a first water channel and a second water channel are provided in the rotating shaft, a water outlet is provided on the upper inner wall of the shells, a water inlet is provided on the lower inner wall of the shells, an air channel is provided in the columns, and a through hole is provided on the lower side of the rotating shaft. The liquid-cooled energy storage system also includes a water reservoir and a cooling device, a water outlet pipe is connected to the bottom of the water reservoir, a water pump is provided on the water outlet pipe, a valve is provided between the water outlet pipe and the second water channel, and the first water channel is connected to a return pipe. The present invention proposes an immersion-type liquid-cooled energy storage system that facilitates the replacement of battery cells, which is convenient for replacing battery cells and does not waste coolant.

A method for treating hearing loss in a subject in need thereof is provided. The method includes providing a combination of transcription factors to induce generation of a hair cell-like cell, thereby treating the hearing loss in the subject. The generated hair cell-like cells exhibit characteristic of mature functional cells that is useful in cell replacement therapy for autologous transplantation.

The invention discloses a combined cell transplantation system for Huntington's disease treatment, a preparation method and application. The invention belongs to the technical field of biomedicine, and aims at solving the problems that when an existing stem cell transplantation technology is used for treating the Huntington's disease (HD), the graft survival rate is low, differentiation uncertainty is high, and integration with a host neural network is difficult. The combined cell transplantation system for treating the Huntington's disease comprises human umbilical cord mesenchymal stromal cells (hUC-MSCs) and striatum organoid (hStrOs), the human umbilical cord mesenchymal stromal cells play a role in immunoregulation and provide endogenous immune microenvironment support, and the human umbilical cord mesenchymal stromal cells play a role in immunoregulation and provide endogenous immune microenvironment support; the striatum organ takes medium spinous projective neurons (MSNs) for expressing DARPP-32 and CTIP-2 as a main body, and undertakes a cell replacement function. The HD cell therapy is promoted to be converted from a traditional single cell replacement mode to an'immune regulation-nerve regeneration 'multi-dimensional functional remodeling mode through cooperation of the HD cell therapy and the Huntington's disease, and a new way is provided for cell therapy of the Huntington's disease.

A memory device is provided, including a memory array and a selection circuit. At least one first faulty cell and at least one second faulty cell that are in the memory array store data corresponding to, respectively, first and second fields of a floating-point number. The selection circuit identifies the at least one first faulty cell and the at least one second faulty cell based on a priority of a cell replacement operation which indicates that a priority of the at least one first faulty cell is higher than that of the at least one second faulty cell. The selection circuit further outputs a fault address of the at least one first faulty cell to a redundancy analyzer circuit for replacing the at least one first faulty cell.

An ejector-type vacuum pump is described, said ejector-type vacuum pump being configured to accommodate two or more ejector cells, each of which two or more ejector cells is separately accessible and replaceable from the outside of the ejector-type vacuum pump. An ejector-cell can be replaced with an ejector-cell replacement insert, thereby allowing for facilitated modulation of the suction power and performance of the ejector-type vacuum pump. Also, modulation of the characteristics of the ejector-type vacuum pump, is described and can easily be accomplished e.g. by replacing an ejector cell with another ejector cell having different characteristics, such as different nozzle characteristics.

The present application provides a kind of more unit, it is used in the printing device with printing part, the printing part is handled object using silk screen mask and is printed with viscous fluid, the more unit has: receiving part, receives the storage rack with multiple shelf parts, multiple shelf parts store the frame capable of supporting replaceable component used in printing device;Lifting part makes the storage rack between the replacement position of replacement replaceable component and the upper position of the replacement position below;And moving part makes the storage rack between the upper position of the storage rack capable of being lifted by lifting part and the storage position for the storage rack to enter the shell inside of printing device.

The invention provides an efficient and repeatable in-vitro differentiation protocol, and human pluripotent stem cells are differentiated into functional midbrain dopaminergic neurons by accurately controlling sequential activation of SHH and FGF8 signal pathways. The protocol comprises five key differentiation stages: neural precursor induction, midbrain mode establishment, midbrain dopaminergic precursor amplification, terminal differentiation and maturation. Experiments prove that after the midbrain dopaminergic neuron obtained by the method is transplanted into a Parkinson's disease model animal body, the survival rate exceeds 80%, and the midbrain dopaminergic neuron can be effectively integrated into a host neural network and improve dyskinesia. According to the differentiation scheme, the purity (gt; gt) of mDA neurons is remarkably improved; 85%) and functional maturity, and a reliable cell source is provided for cell replacement treatment of Parkinson's disease.

The application belongs to the technical field of regenerative medicine, and discloses a kind of organoid culture method derived from human and non-human primate subventricular zone neural stem cells. By optimizing the medium formula and regulating transcription factors, the organoid is successfully induced to differentiate into CRABP1-expressing neuronal precursors. These cells express TAC3, and the application overcomes the limitations of existing technologies in simulating primate-specific neural lineages and complex brain structures, providing a breakthrough in vitro model for studying neural development, neurological diseases and drug development. The established system not only provides a new tool for studying the development of primate nervous system and disease mechanism, but also provides a reliable experimental platform and transplantable cell source for developing targeted drugs, constructing advanced disease models and conducting cell replacement therapy.

The invention relates to the technical field of biological flora, in particular to a thickened oil biological flora recycling system which comprises a flora screening module, a reaction delay recognition module, a structural fatigue evaluation module, a proliferation behavior calculation module and a thallus replacement suggestion module. According to the method, the efficiency and economical efficiency of heavy oil biodegradation are improved by screening the microbial flora adapting to different heavy oil environments and optimizing and recycling the microbial flora, and the metabolic capability and environmental adaptability of strains can be accurately evaluated by obtaining detailed state parameters of the heavy oil sample and dividing the thallus culture environment; according to the method, the starting delay time and the product concentration peak value of a flora degradation reaction are monitored, efficient response strains are recognized, the flora structure is optimized, the response speed of the biodegradation process is increased, the biological efficiency of heavy oil treatment is improved, fatigue and proliferation behaviors of the strain structure are carefully evaluated, and dynamic optimization of flora iteration is achieved.

The invention belongs to the technical field of regenerative medicine, and discloses an organoid culture method derived from neural stem cells in subventricular regions of human and non-human primates. By optimizing a culture medium formula and regulating and controlling transcription factors, the organoid is successfully induced to be differentiated into the neuron precursor for expressing the CRABP1. The cell expresses TAC3, the limitation of the prior art in simulation of special neuropedigree and complex brain structure of primates is overcome, and a breakthrough in-vitro model is provided for research on neurodevelopment and nervous system diseases and drug development. The established system not only can provide a new tool for researching the development law and disease mechanism of the primate nervous system, but also can provide a reliable experimental platform and a transplantable cell source for developing targeted drugs, constructing advanced disease models and developing cell replacement therapy.

A grabbing device and a cell production line. The grabbing device comprises a frame, a first clamping assembly, a first drive assembly, a second clamping assembly and a second drive assembly; the first clamping assembly comprises a first clamping member and a second clamping member which are oppositely arranged in a first direction; the first drive assembly is installed on the frame and used for driving the first clamping member to move in the first direction; the second clamping assembly comprises a third clamping member and a fourth clamping member which are oppositely arranged in a second direction; and the second drive assembly is installed on the frame and used for driving the third clamping member and the fourth clamping member to move in the second direction. The grabbing device can limit and grab multiple cells having different sizes in first directions and second directions, is thus highly adaptable, such that cell replacement processes do not need disassembling and changing grabbing devices, thus improving the production efficiency.

This invention discloses an Isl1-mimicking polypeptide, TAT-Isl1-ELE-1, containing 40 amino acids and consisting of a TAT sequence that promotes polypeptide entry into cells, a linker peptide, and a target sequence. The target sequence is amino acids 121-141 of the human Isl1 protein. The TAT-Isl1-ELE-1 polypeptide possesses Isl1-like functions and can effectively reprogram mouse spinal cord reactive astrocytes into motor neuron-like cells. Based on the amino acid sequence and spatial structure of this polypeptide, a novel small molecule drug can be designed, which can be synthesized in large quantities and is easy to operate clinically. This provides a new and viable approach for cell replacement therapy and regenerative medicine research after spinal cord injury (SCI), thereby achieving better SCI repair and functional reconstruction effects.

The present disclosure pertains to a method for treating Type 1 diabetes mellitus by using tolerogenic dendritic cells (tDCs) as an adjunct to stem cell-derived β-cell (SCislet) replacement therapy. The tDCs are genetically modified to induce immunotolerance and are administered in conjunction with SCislet autografts or allografts to enhance their survival and function, providing a potential cure or disease-modifying treatment for T1DM.

The invention relates to the technical field of regenerative medicine and cell therapy, in particular to a culture medium for inducing mesenchymal cells to differentiate into insulin-secreting cells and application of the culture medium. By accurately regulating and controlling the oxidation-reduction state of NAD < + > / NADH in cells, the composition proportion of exogenous fatty acid, the dynamic supply concentration of glucose and the anti-oxidative stress level, the differentiation efficiency is remarkably improved, the induction period is shortened, and the method is suitable for industrial production on the premise of not depending on recombinant protein induction factors such as Activin A and Wnt3a. And a mature beta-like cell with stable glucose stimulus dependent insulin secretion (GSIS) capability is obtained. The kit is especially suitable for human adipose tissue-derived mesenchymal stem cells, and can be used as an independent kit product for preclinical research and drug screening of diabetes cell replacement therapy.

A memory device is provided, including a memory array and a selection circuit. At least one first faulty cell and at least one second faulty cell that are in the memory array store data corresponding to, respectively, first and second fields of a floating-point number. The selection circuit identifies the at least one first faulty cell and the at least one second faulty cell based on a priority of a cell replacement operation which indicates that a priority of the at least one first faulty cell is higher than that of the at least one second faulty cell. The selection circuit further outputs a fault address of the at least one first faulty cell to a redundancy analyzer circuit for replacing the at least one first faulty cell.

The technology described herein is directed to a stroma-free method of T cell differentiation using soluble Notch ligands. Soluble Notch oligomeric complexes and compositions thereof, as well as methods for making them, are also described herein. Further described herein are immune cells differentiated using stroma-free methods and compositions comprising such immune cells. In some embodiments, the immune cells may be genetically modified. In some embodiments, the immune cells or compositions comprising the immune cells may be administered to a patient as cell replacement therapy to treat a condition.

A method for treating hearing loss in a subject in need thereof is provided. The method includes providing a combination of transcription factors to induce generation of a hair cell-like cell, thereby treating the hearing loss in the subject. The generated hair cell-like cells exhibit characteristic of mature functional cells that is useful in cell replacement therapy for autologous transplantation.

This invention provides a non-human vertebrate exhibiting a higher human liver cell growth rate, a higher human liver cell replacement rate, and higher histological-physiological human reproducibility than existing non-human vertebrates comprising the human liver transplanted therein and a method for producing such non-human vertebrate. Specifically, the method for producing a transgenic non-human vertebrate comprising human liver cells transplanted therein comprises transplanting human liver cells in a non-human vertebrate that has impaired or lowered immune reactions against humans in the presence of human IL-6 in vivo.

Provided herein are peptide amphiphiles (PAs) and supramolecular PA nanostructures that mimic glial derived neurotrophic factor (GDNF), a growth factor that induces neuronal survival, maturation, and increased electrical activity. In particular, injectable biomaterials comprising GDNF mimetic PAs are provided, as well as methods of using GDNF mimetic PAs for the treatment or prevention of neurological injuries, diseases, and disorders, including concurrently with cell replacement therapy.

Disclosed are lung progenitor cells and methods of generating the lung progenitor cells starting from mammalian pluripotent stem cells. The lung progenitors can be used as therapeutic treatments for various pulmonary disorders or injuries. The lung progenitor cells may also be used to model lung diseases / conditions and screen for desired agents.

The invention discloses a polypeptide simulating Sox2 and application of the polypeptide, and belongs to the technical field of biological medicine, and the amino acid sequence of the polypeptide is GRKKRRQRRRPQGGSGHSGPQHPGLNAHGAAQMQPMHRY. According to the invention, the TAT-Sox2-EL-1 polypeptide capable of simulating the Sox2 function is successfully constructed, and in vitro, the polypeptide can be used for effectively reprogramming mouse spinal cord reactive astrocytes into motor neuron-like cells; and a new selectable way is provided for the medical research on cell replacement treatment and cell regeneration after SCI.