Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

56results about How to "Stops growth" patented technology

Administration of TLR7 ligands and prodrugs thereof for treatment of infection by hepatitis C virus

This invention relates to methods for treating or preventing hepatitis C virus infections in mammals using Toll-Like Receptor (TLR)7 ligands and prodrugs thereof. More particularly, this invention relates to methods of orally administering a therapeutically effective amount of one or more prodrugs of TLR7 ligands for the treatment or prevention of hepatitis C viral infection. Oral administration of these TLR7 immunomodulating ligands and prodrugs thereof to a mammal provides therapeutically effective amounts and reduced undesirable side effects.
Owner:ANDADYS PHARMA INC

Cdki pathway inhibitors and uses thereof

The invention relates to the compounds and methods for inhibiting the Cyclin-Dependent Kinase Inhibitor (CDKI) pathway. More particularly, the invention relates to compounds and methods for inhibiting the CDKI pathway for studies of and intervention in senescence-related and other CDKI-related diseases.
Owner:SENEX BIOTECHNOLOGY INC

Cyclic dinucleotides for cytokine induction

A cyclic dinucleotide compound of Formula (I):wherein X1 is H or F; X2 is H or F; at least one among X1 and X2 is a fluorine atom; Z is OH, OR1, SH or SR1, wherein: R1 is Na or NH4, or R1 is an enzyme-labile group which provides OH or SH in vivo such as pivaloyloxymethyl; B1 and B2 are bases chosen from Adenine, Hypoxanthine or Guanine, and B1 is a different base than B2 and a pharmaceutically acceptable salt thereof. Pharmaceutical compositions including the cyclic dinucleotide, as well as their use in the treatment of a bacterial infection, a viral infection or a cancer are also described.
Owner:KAYLA THERAPEUTICS

IDO Inhibitors

InactiveUS20130289083A1Stops growthAntibacterial agentsBiocideDioxygenase activityAnticarcinogen
Presently provided are methods for (a) modulating an activity of indoleamine 2,3-dioxygenase comprising contacting an indoleamine 2,3-dioxygenase with a modulation effective amount of a compound as described in one of the aspects described herein; (b) treating indoleamine 2,3-dioxygenase (IDO) mediated immunosuppression in a subject in need thereof, comprising administering an effective indoleamine 2,3-dioxygenase inhibiting amount of a compound as described in one of the aspects described herein; (c) treating a medical conditions that benefit from the inhibition of enzymatic activity of indoleamine-2,3-dioxygenase comprising administering an effective indoleamine 2,3-dioxygenase inhibiting amount of a compound as described in one of the aspects described herein; (d) enhancing the effectiveness of an anti-cancer treatment comprising administering an anti-cancer agent and a compound as described in one of the aspects described herein; (e) treating tumor-specific immunosuppression associated with cancer comprising administering an effective indoleamine 2,3-dioxygenase inhibiting amount of a compound as described in one of the aspects described herein; and (f) treating immunsupression associated with an infectious disease, e.g., HIV-1 infection, comprising administering an effective indoleamine 2,3-dioxygenase inhibiting amount a compound as described in one of the aspects described herein.
Owner:NEWLINK GENETICS

Incontinence garments with a silver lining infection stopper

Antibiotics used to cure Uterine Tract Infections have resulted in the growth of MRSA. and other antibiotic resistant bacteria. The CDC guidelines state “Disposable diapers cause 95% of all UTI'S”. The procedures used for “prevention” are ineffective because millions of bacteria in incontinence garments continue to double every 20 minutes. Silver ions in bandages are used to cure severly damaged skin, such as in burns. The best two in a large scale test achieved results in just 30 minutes. This Invention uses silver ions in linings next to the skin to stop the growth of over 250 kinds of infectious bacteria on it's surface and the body parts it touches. It achieves results in 30 minutes, equal to the most highly rated bandages . . . for every level of incontinence for both sexes.
Owner:ARRON STANLEY

Electroforming method

A mold is fabricated with a cavity formed in an insulating layer formed so as to be placed on an upper surface of a conductive base material. This mold is disposed in an electrolyte bath to be applied with a voltage, and a metal is electrodeposited on the bottom surface of the cavity to electroform a metal-formed product in the cavity. In this electrodepositing process, when the width of the cavity is taken as W and a vertical height of a head space between an upper opening of the cavity and an upper surface of a metal layer is taken as H, the growth of the metal layer is stopped so that the height H of the head space left above the metal layer satisfies: H≧W / 2.85 where 300 μm≦W; H≧W / 3.75 where 200 μm≦W<300 μm; H≧W / 4 where 100 μm≦W<200 μm; and H≧W / 10 where W<100 μm.
Owner:ORMON CORP

Method to Arrest Growth of Invasive Species' Seeds While in Non-Natural Environment Prior to Transport

ActiveUS20140130409A1Easily effectuateProtect pristine uncontaminatedBiocideSeed and root treatmentChemical compositionNatural environment
This invention pertains to the application of a chemical composition rinse agent to equipment or vehicles and apparatuses generally used in non-agricultural areas in an effort to prevent the spread of undesired seeds of invasive species. The rinse agent comprises a composition known to inhibit growth of the mature variant of the invasive species. The application would be directly to equipment or vehicles or other mobile apparatuses.
Owner:VOLLMER JENNIFER +1

Anti-idiotype anti-cea antibody molecules and its use as cancer vaccine

The present invention provides molecules, preferably designed immunoglubulins, suitable for use as an anti-idiotype vaccine to CEA positive tumours. The molecules induce both an MHC class I and MHC class II mediated immune response to the CEA bearing tumour cells for an efficient and sustained host anti-tumour response. The present invention provides modified versions of anti-idiotype anti-CEA antibodies, preferably mouse antibody 708, with improved vaccination properties. The modifications are related to the introduction of sequences tracts deriving from e.g. CEA, CD55 antigen and CEA cancer-specific MHC epitopes into the variable regions of said antibody molecules.
Owner:CARTER GRAHAM +1

Medical and non-medical devices made from hydrophilic rubber materials

This invention relates to medical, health care and non-medical devices comprising a rubbery or elastomeric polymer material taking up more than 5% by weight of water and at most 500% by weight of water after immersion in demineralized water at room temperature for a sufficient time to reach saturation. The material may be in the form of a foam, or in the form of a coating adapted for adhesion to a substrate, or in the form of a sheet, or in the form of a fiber, and may comprise: —repeating units from one or more hydrophobic organic monomers, and —repeating units from one or more monomers (a) being modified with one or more hydrophilic side groups.
Owner:KONINKLJIJKE PHILIPS NV

Method and system for display of structures or regions of interest

A system and a method for extracting regions of interest from a medical image in order to obtain an image useable by a user. The system includes a user interface comprising virtual buttons that the user can select using an input, the buttons enabling the user to control a selected region extraction method using a region growth method to extract a region The region extraction method depend on which virtual buttons are selected by the user. The user interface also includes a window in which the result of extraction of the region of interest can be displayed, as the region is being grown.
Owner:GENERAL ELECTRIC CO

CDKI pathway inhibitors and uses thereof

ActiveUS8598344B2Promotes an increase in inductionEnhancing induction of G1 cell cycle arrestBiocideOrganic active ingredientsDiseaseBiochemistry
The invention relates to compounds for inhibiting the Cyclin-Dependent Kinase Inhibitor (CDKI) pathway. More particularly, the invention relates to compounds for inhibiting the CDKI pathway for studies of and intervention in senescence-related and other CDKI-related diseases.
Owner:SENEX BIOTECHNOLOGY INC

CDKI pathway inhibitors and uses thereof

The invention relates to the compounds and methods for inhibiting the Cyclin-Dependent Kinase Inhibitor (CDKI) pathway. More particularly, the invention relates to compounds and methods for inhibiting the CDKI pathway for studies of and intervention in senescence-related and other CDKI-related diseases.
Owner:SENEX BIOTECHNOLOGY INC

System for transporting and/or washing and/or pasteurisation thermal treatment of foodstuffs, particularly leaf products

The present invention relates to a system for transporting and / or washing and / or pasteurisation thermal treatment of foodstuffs, particularly leaf products comprising at least a treatment section. The treatment section can be comprised of one or more sections of rectilinear tubes and one or more corresponding curved tube sections, wherein products within the treatment section being conveyed by a fluid, such as water, flowing along the tubes.
Owner:TURATTI S R I

Method to arrest growth of invasive species' seeds while in non-natural environment prior to transport

ActiveUS9084395B2Protect pristine uncontaminatedEasily effectuatedBiocideDead animal preservationChemical compositionInvasive species
This invention pertains to the application of a chemical composition rinse agent to equipment or vehicles and apparatuses generally used in non-agricultural areas in an effort to prevent the spread of undesired seeds of invasive species. The rinse agent comprises a composition known to inhibit growth of the mature variant of the invasive species. The application would be directly to equipment or vehicles or other mobile apparatuses.
Owner:VOLLMER JENNIFER +1

Methods and means to produce abiotic stress tolerant plants

This disclosure relates to the field of plant molecular biology and concerns methods for enhancing the abiotic stress tolerance in plants by modulating the expression of a gene involved in the gibberellin biosynthesis during the period of abiotic stress. This disclosure also provides chimeric constructs useful in the methods disclosed herein. In addition, transgenic plants having an enhanced abiotic stress resistance are provided herein.
Owner:VLAAMS INTERUNIVERSITAIR INST VOOR BIOTECHNOLOGIE VZW +1

Antireflection film, and optical member and optical apparatus each using the antireflection film

Provided are an antireflection film having a high antireflection effect in a broad band, including, on a substrate, in this order: a particle layer containing particles; and a layer having a textured structure containing aluminum oxide as a main component, in which the particle layer has an aluminum oxide textured structure between the particles, and an optical member and an optical apparatus each using the antireflection film.
Owner:CANON KK

Nanotube forming methods

A nanotube forming method includes growing a plurality of nanotubes to an intermediate length that is deterministic of nanotube intrinsic conductivity. Individual nanotubes exhibit an effective conductivity, which varies among the plurality of nanotubes. The method includes completing growth of nanotubes exhibiting effective conductivities inside a selected range without completing growth of nanotubes exhibiting effective conductivities outside the selected range. Before completing nanotube growth, the method may further include stopping nanotube growth and screening out nanotubes exhibiting conductivities outside the selected range. The screening out of nanotubes may include deforming or masking nanotubes exhibiting conductivities outside the selected range. Deforming nanotubes may include applying a potential.
Owner:MICRON TECH INC

Method for the treatment of cancer

The invention is based on the surprising finding that treatment with a chemotherapeutic agent such as 5-fluorouracil (5-FU) and an autophagy inducer effectively inhibit the continued growth of, and prevent the recovery following drug withdrawal, of cancer cells. In vivo, drug resistance from a failure to adequately engage in apoptotic programmed cell death leads to a recurrence of cancer and tumours can remain dormant for periods of time before re-emerging as drug resistant metastases. It has been hypothesised that autophagy (Type II cell death) may help cancer cells survive in response to growth limiting conditions, such as nutrient depletion, hypoxia, absence of growth factor, or presence of cytotoxic drug. LiCl is a known autophagy inducer and accelerates cell survival to autophagic programmed cell death.
Owner:UNIV COLLEGE CORK NAT UNIV OF IRELAND CORK

Continous hot-rolling facility

A continuous hot-rolling mill includes an upper rolling unit including a plurality of rolling stands, and a lower rolling unit including a plurality of rolling stands and disposed downstream with respect to the upper rolling unit in a workpiece passing direction in which a workpiece to be rolled is passed. The two or more rolling stands of the lower rolling unit are differential or very-small-diameter rolling stands. Each of the two or more differential or very-small-diameter rolling stands of the lower rolling unit is provided with a drive motor having a capacity greater than that of any one of drive motors included in the rolling stands disposed upstream the differential or very-small-diameter rolling stands. The continuous hot-rolling mill is suitable for producing hot-rolled, fine-grained steel sheets and is excellent in sheet passing abilities for preventing the steel sheet from meandering and for rolling the steel sheet in a desired shape.
Owner:NAKAYAMA STEEL WORKS +1

Composition and Method for Selective Cytostasis

A method of inducing cytostasis in a population of HIV-infected cells is disclosed which comprises applying to a population of HIV-infected cells a cytostatically effective amount of an inhibitor comprising an isolated peptide having the amino acid sequence FCRFLLCPSRTSD or SQCEQEGGRCRFLLCPSRTSNIGKLGCEPLWKC CKRWGG, or a conservative variant thereof, whereby cell growth in at least a portion of the HIV-infected cells is arrested, rendering the growth-arrested cells non-HIV producing. The peptide may be conjugated with an agent that is capable of selectively targeting HIV-infected cells.
Owner:KILMON JOSEPH

Method for manufacturing a porous synthetic diamond material

A method of manufacturing a diamond layer having a porous three-dimensional structure, the method being of the type which includes growing the diamond layer from a sacrificial material and gradually decomposing said sacrificial material during growth of the diamond layer, said material including the following steps; 1) provision of a substrate capable of supporting the plasma-enhanced chemical vapour deposition growth of the diamond layer on at least one of the surfaces of of the substrate, the substrate comprising, on said at least one surface thereof, a layer made of a sacrificial material having a porous three-dimensional structure capable of gradually decomposing upon contact with said plasma, the layer of sacrificial material containing diamond grains of nanometric size, and 2) growth by plasma-enhanced chemical vapour deposition of the diamond layer from diamond grains and concomitant and gradual decomposition of the scrificial material upon contact with said plasma.
Owner:COMMISSARIAT A LENERGIE ATOMIQUE ET AUX ENERGIES ALTERNATIVES

Use of a Compound in Obtaining Cytoskeleton Blockage and Cell Elongation

InactiveUS20100093794A1Induce apoptosisInduces the caspase-3 activation and apoptosisBiocideOrganic chemistryPhosphorylationQuinoline
A use of a compound in obtaining cytoskeleton and cell elongation is disclosed, the compound is 7-chloro-6-piperidin-1-yl-quinoline-5,8-dione with a chemical formula of C14H13CIN2O2, is designated as PT-262. The PT-262 can induce cell elongation by stabilization of the F-actin and induction of the abnormal actin polymerization in cancer cells, further, the PT-262 possesses antitumor activity and can block survival pathway of the cancer cells, resulting in cancer cells apoptosis, and the PT-262 can induce growth arrest and inhibition of cell cycle. PT-262 stabilizes cancer cells cytoskeleton that results in an irreversible cell elongation, decreases the levels of cyclin B1 and phospho-cdc2 proteins, and inhibits the survival signal pathway of Ras-ERK proteins. The PT-262 also inhibits the mitochondrial membrane potential and induces the caspase-3 activation and apoptosis in the cancer cells.
Owner:CHEN CHENG SHU +2

Process to form nano-sized materials, the compositions and uses thereof

Various embodiments of the invention include systems and methods of generating nano-sized salt particles. These methods include generation of a supersaturated solution of a salt MX by mixing of salts MY and NX in which the solubility of MX is lower than that of MY, NX or NY. In some embodiments, nano-sized particles of MX are grown further by further adiabatic addition of salts MY and / or NX. In some embodiments, MX includes potassium nitrate. Some embodiments include compositions of MX configured for use in treatment of dentine sensitivity.
Owner:OROSCI

Formulation for targeting cancer in humans and canines

The present invention provides formulation / composition comprising phytonutrients with natural chlorotoxins for targeting cancer, infection, inflammation and pain without any side effects and a method for synthesizing the same. The raw materials are cleaned and dried and to prepare coarse powder of 40 mesh size, extracted with solvent (comprising water:alcohol in a ratio of 40:60) in a ratio of 4:1 with overnight soaking. Prior to cold extraction, the mixture is macerated for 4 hours. The mixture is refluxed for 2 hours at 80° C. The addition of ethanol, maceration and refluxing steps are repeated three times and above solvent is added, if required. The residue is checked for complete extraction after every refluxing step. The extract / residue is filtered and concentrated under vacuum. The extract / residue is vacuum tray dried at 70-80° C. for 12 hours. The extract / residue is scraped and dried lumps of the extract / residue are milled. The extract / residue is sieved and packed.
Owner:RAMANA VIVEKANANDA +1
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products