Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

42 results about "LIVER CELL DAMAGE" patented technology

Cirrhosis is a type of liver damage where healthy cells are replaced by scar tissue. Common causes include excessive drinking of alcohol, hepatitis B and C, and fatty liver caused by obesity and diabetes.

Cadinane type sesquiterpene as well as preparation method and application thereof

The invention discloses a cadinane type sesquiterpene as well as a preparation method and application thereof. The cadinane type sesquiterpene is separated from cinnamon bark, and has at least one of structural formulas shown as a formula (I), a formula (II), a formula (III) and a formula (IV). Liver protection activity evaluation is carried out by applying an alcohol-induced hepatocyte injury model, and it is found that the cadinane type sesquiterpene can effectively relieve alcohol-induced AML-12 hepatocyte injury; the dumarane sesquiterpenes can inhibit the alcoholic liver disease and relieve fat accumulation, so that the dumarane sesquiterpenes have the anti-alcoholic liver disease activity, can be applied to preparation of the anti-alcoholic liver disease drugs, and have good research and development prospects; belongs to the field of natural medicinal chemistry.
Owner:GUANGDONG UNIV OF TECH

Application of compound AZD5718 in preparation of medicine for preventing and / or treating cholestatic liver disease

The invention discloses application of a compound AZD5718 in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. The compound AZD5718 can effectively improve hepatocyte damage and bile metabolism disorder caused by Mdr2 gene deletion, provides solid experimental data support for developing novel drugs for treating cholestatic liver diseases, is expected to provide differentiated therapeutic drug choices for clinic, and has important medical value and social significance.
Owner:CENT SOUTH UNIV

Use of a natural terpenoid in the manufacture of a medicament

PendingCN122398785ADiseaseEngineering
This invention relates to the use of a natural terpene compound in pharmaceuticals, said natural terpene compound having the structure shown in formula (I), and having the function of preparing a compound for the prevention or treatment of hypoxia-inducible factor-1. α Use in medicines for diseases associated with abnormally elevated activity. This invention has discovered that the compound possesses hypoxia-inducible factor-1. α It exhibits inhibitory activity, effectively suppressing macrophage inflammatory responses and hepatocyte damage. It also demonstrates significant protective function against lipopolysaccharide / galactosamine-induced acute liver injury in mice, and can be used as a lead compound for the preparation of new drugs or drugs for the prevention and treatment of acute liver injury.
Owner:SHANGHAI JIAOTONG UNIV +1

Application of polyethylene glycol modified black phosphorus nanosheets in prevention and treatment of acute liver injury

PendingCN122376770APolyethylene glycolApoptosis
The application relates to the field of nanobiomedical technology, and particularly relates to application of polyethylene glycol modified black phosphorus nanosheets in prevention and treatment of acute liver injury. The polyethylene glycol modified black phosphorus nanosheets not only have a significant active oxygen scavenging capacity, but also have calcium ion chelation and buffering capacity, can simultaneously regulate intracellular oxidation-reduction homeostasis and calcium homeostasis, inhibit intracellular calcium overload, especially mitochondrial calcium overload, maintain mitochondrial function, and further reduce liver cell damage, apoptosis and inflammatory response, and play a liver protection role. The application finds that the black phosphorus nanosheets are used in calcium ion chelation and inhibition of cell calcium overload, and breaks through the limitation that the black phosphorus nanosheets are mainly used as active oxygen scavenging materials in the prior art. The material can also adsorb copper ions and realize radioactivity copper labeling without chelating agent, and can be used for liver enrichment tracing and integrated diagnosis and treatment application. The material has a significant protective effect on paracetamol-induced acute liver injury.
Owner:THE SEVENTH AFFILIATED HOSPITAL SUN YAT SEN UNIV SHENZHEN

Endogenous substances serving as biomarkers of alcohol-related liver diseases and prevention and treatment application of endogenous substances

The invention belongs to the technical field of biological medicine, and relates to a novel application of endogenous substances in alcohol related liver disease (ALD). The invention proposes for the first time that an endogenous substance with regular concentration change in the ALD process can be used as a biomarker for auxiliary diagnosis and / or stage evaluation of ALD, the exogenous supplement of the endogenous substance has a prevention and treatment effect on ALD, and the endogenous substance has double values of being used as an excellent biomarker and an effective therapeutic agent. The substances include but are not limited to taurochenodeoxycholic acid (TCDCA), dehydroepiandrosterone sulfate (DHEA-S) and the like. Wherein the serum concentration of TCDCA is obviously increased along with disease progression, and the concentration of DHEA-S is obviously reduced. The diagnostic value of the substance on ALD is remarkably superior to that of a traditional liver injury marker, and ethanol-induced liver cell injury and mouse liver pathological change can be remarkably improved through exogenous supplementation. The invention provides a brand new strategy for accurate diagnosis and prevention of ALD.
Owner:CHINA AGRI UNIV

Medicinal and edible dual-purpose composition with function of regulating fasting blood-glucose of type 2 diabetes and application of medicinal and edible dual-purpose composition

The invention discloses a medicinal and edible composition with an effect of regulating fasting blood-glucose of type 2 diabetes and application of the medicinal and edible composition, and belongs to the field of medicinal and edible nutritional health-care foods. The medicinal and edible dual-purpose composition with the function of regulating and controlling fasting blood glucose of type 2 diabetes mellitus comprises the following components in parts by weight: 7-9 parts of radix puerariae, 3-5 parts of astragalus membranaceus, 2-4 parts of radix ophiopogonis and 1-3 parts of liquorice. Or 7-9 parts of radix puerariae, 3-5 parts of radix asparagi, 3-5 parts of radix rehmanniae and 1-3 parts of liquorice. All the raw materials of the medicinal and edible combined species are medicinal and edible substances, so that the medicinal and edible combined species have the medicinal effects of traditional Chinese medicines, are safer and lower in toxic and side effects, can effectively regulate and control fasting blood-glucose of type 2 diabetes, can remarkably improve liver cell injury, has a better protection effect on the liver, and is suitable for patients with type 2 diabetes to take for a long time.
Owner:JIANGNAN UNIV

Use of AML-12 exosomes in the preparation of a medicament for treating cholestatic liver injury

The application discloses application of AML-12 exosomes in preparation of medicines for treating cholestatic liver injury, relates to the technical field of biological medicine, and discloses application of AML-12 cell-derived exosomes in preparation of medicines for preventing and treating ANIT-induced cholestatic liver injury; the treatment is manifested as reduction of alanine aminotransferase, aspartate aminotransferase and alkaline phosphatase levels in serum. The application proves that the AML-12 cell-derived exosomes have a significant treatment effect on ANIT-induced cholestatic liver injury, successfully opens up the application of the biological preparation in a brand-new disease field, and fills the blank of the prior art; through in-vivo experiments, it is proved that AML-12 exosome treatment can significantly reduce liver cell injury markers and alkaline phosphatase, a key index of cholestasis, in serum of ANIT model mice, and improve pathological injury of liver tissue, thereby constituting a complete curative effect evidence chain from function to morphology.
Owner:CHILDRENS HOSPITAL OF CHONGQING MEDICAL UNIV

Use of pyridostigmine in the preparation of a medicament for preventing and treating non-alcoholic fatty liver disease

PendingCN122163602ADigestive systemHeterocyclic compound active ingredientsDiseaseSerum glutamate pyruvate transaminase
This application discloses the application of pyridostigmine in the preparation of drugs for the prevention and treatment of non-alcoholic fatty liver disease (NAFLD). Validation was conducted using animal models of NAFLD induced by three different etiologies: methionine-choline deficiency diet, high-fat diet, and leptin gene knockout. Pyridostigmine significantly improved vagal nerve activity in the model animals (e.g., improving high-frequency and baroreflex sensitivity in heart rate variability), effectively corrected serum lipid metabolism disorders (reducing LDL cholesterol), alleviated hepatocyte damage (reducing ALT and AST), and at the histopathological level, reduced hepatic steatosis, decreased inflammatory cell infiltration, and inhibited collagen deposition, thereby achieving the prevention and treatment of NAFLD.
Owner:HOSPITAL OF STOMATOLOGY XIAN JIAOTONG UNIVERSITY

Yellow-rose yellow-meat boletus polysaccharide as well as preparation method and application thereof

The invention belongs to the technical field of fungal polysaccharide application, and particularly relates to a yellow-rose yellow-meat boletus polysaccharide as well as a preparation method and application thereof. The preparation method comprises the following steps: extracting crude polysaccharide from boletus rosea sporocarp through a water extraction and alcohol precipitation method, and then carrying out deproteinization, decoloration and DEAE-52 cellulose column chromatography separation and purification to obtain the purified polysaccharide BPP-1 of the boletus rosea water component. CCl4 is selected as an inducer of oxidative stress injury of the MIHA cells to construct a hepatic cell oxidative injury model, and the model is utilized to evaluate the protective effect of BPP-1 on CCl4-induced MIHA cell hepatic injury. The result shows that the BPP-1 reduces the release of ALT and AST, improves the GSH level and the SOD enzyme activity at the same time, inhibits the generation of a lipid peroxidation product MDA, and effectively reduces the damage of CCl4 to liver cells. The results show that BPP-1 has a certain protection effect on CCl4-induced hepatocyte injury, and BPP-1 may be a potential antioxidant and can alleviate oxidative injury of liver.
Owner:HAINAN NORMAL UNIV

Method for constructing carbon tetrachloride damage model based on three-dimensional liver chip and evaluating nutrition intervention

The invention discloses a carbon tetrachloride damage model construction and nutrition intervention evaluation method based on a three-dimensional liver chip, and belongs to the technical field of microfluidics and biological medicines. According to the method, an in-vitro bionic liver tissue model is constructed by utilizing a three-dimensional liver chip, liver cell injury is induced by perfusing carbon tetrachloride, on the basis, substances such as algae-derived extracellular vesicles are added for repairing intervention, and meanwhile, contrastive analysis is performed with a two-dimensional plate culture system. Results show that the secretion level and the function maintenance time of albumin, urea and the like of liver cells in a liver chip model are superior to those of two-dimensional culture, and after nutrient intervention is carried out, liver injury indexes such as ALT, AST and the like in the chip model are remarkably reduced, and the cell activity and the metabolic function are obviously recovered. The model can be used for evaluating the curative effect of nutrient substances on chemical liver injury, overcomes animal experiment species difference and two-dimensional culture limitation, provides an efficient and sensitive in-vitro research platform for medicine and nutrition function screening, and has wide application prospects and industrialization potential.
Owner:DALIAN POLYTECHNIC UNIVERSITY

Application of dracocephalum moldavica total flavonoids in preparation of medicine for preventing and / or treating heart failure with preserved ejection fraction

The invention provides application of dracocephalum moldavica total flavonoids in preparation of a medicine for preventing and / or treating heart failure with preserved ejection fraction, and belongs to the technical field of biological medicine. After a heart failure model mouse with reserved ejection fraction is constructed and dracocephalum moldavica general flavone is administrated, research finds that compared with an HFpEF model group mouse, the myocardial cell damage degree of the dracocephalum moldavica general flavone group mouse is obviously reduced, the myocardial hypertrophy is obviously reduced, and the myocardial hypertrophy is obviously reduced. The total flavonoids of dracocephalum moldavica can significantly reduce pathological cardiac hypertrophy and myocardial fibrosis of HFpEF model mice, improve cardiac diastolic function, and reduce the degree of liver cell injury and lipid metabolism imbalance, thereby preventing and / or treating heart failure with ejection fraction retention.
Owner:SHIHEZI UNIVERSITY

Biphenyl compound urolithin B pepper acid ester and application thereof in anti-liver injury aspect

The invention belongs to the technical field of medicines, and discloses a biphenyl compound urolithin B pepper acid ester and application thereof in the aspect of liver injury resistance. In particular to application of a biphenyl compound urolithin B pepper acid ester extracted and separated from a Zhaxun medicinal material and an anti-liver injury aspect, and a preparation method of Urolite B pipronate is reported. The invention belongs to the technical field of medicine. A biological activity test shows that the compound Urolite B piperimate has the capability of remarkably improving the cell survival rate in an in-vitro hepatocyte injury model induced by paracetamol (APAP), which is higher than that of a positive control drug bicyclol, and can be used for preparing the anti-liver injury medicine.
Owner:INST OF MATERIA MEDICA CHINESE ACAD OF MEDICAL SCI +1

Application of solamargine in preparation of medicine for preventing and / or treating cholestatic liver disease

The invention discloses application of solamargine in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. By simulating a classical Mdr2- / -mouse model of clinical cholestasis pathology, the solamargine is researched and proved to treat cholestatic liver injury by improving hepatocyte injury, bile duct dysfunction and bile metabolism disorder, and the solamargine shows good application potential in clinical treatment of cholestatic liver diseases.
Owner:CENT SOUTH UNIV

Application of compound turtle shell liver-softening tablet in preparation of medicine for preventing and / or treating intrahepatic cholangiocarcinoma

The invention discloses application of a compound turtle shell liver softening tablet in preparation of a medicine for preventing and / or treating intrahepatic cholangiocarcinoma. The prevention and / or treatment of the intrahepatic cholangiocarcinoma is embodied in at least one of the following aspects: 1) reducing the liver weight of a patient with the intrahepatic cholangiocarcinoma; the invention relates to a pharmaceutical composition for treating intrahepatic cholangiocarcinoma, in particular to a novel pharmaceutical composition for treating intrahepatic cholangiocarcinoma, which has the advantages that the pharmaceutical composition can be used for treating intrahepatic cholangiocarcinoma, reducing liver cell injury and liver fiber hyperplasia of patients with intrahepatic cholangiocarcinoma, regulating cholangiocarcinoma-related protein pathways of the patients with intrahepatic cholangiocarcinoma and inhibiting cancer cell proliferation.
Owner:CAPITAL UNIVERSITY OF MEDICAL SCIENCES

IncLRFIF and application thereof in preparation of medicine for treating laying hen fatty liver hemorrhagic syndrome

ActiveCN120888551AOrganic active ingredientsDigestive systemAST activityLipid Transport
The invention relates to the field of biological medicine, in particular to lncLRFIF and application of the lncLRFIF in preparation of medicine for treating laying hen fatty liver hemorrhagic syndrome. The invention provides lncLRFIF. It is found for the first time that lncLRFIF can be used for preparing a medicine for treating the fatty liver hemorrhagic syndrome of laying hens. According to the specific embodiment of the invention, lncLRFIF is knocked down through siRNA, so that the activities of ALT and AST in the chicken primary hepatocyte supernatant treated by FFAs are recovered, lipid droplet accumulation and the content of TG and T-CHO are remarkably reduced, lipid synthesis is increased, lipid transport is increased, the content of ATP and ROS in mitochondria is increased, and mitochondrial respiration and functions are recovered. It can be seen that lncLRFIF can improve liver cell damage caused by FFAs and regulate lipid metabolism. The invention enriches the pathogenesis of the fatty liver hemorrhagic syndrome of laying hens, and provides a new idea for improving the egg laying performance of poultry.
Owner:JIANGXI AGRICULTURAL UNIVERSITY

Application of ferroptosis in alpha-amatoxin induced hepatocyte injury

The invention discloses an application of ferroptosis in alpha-amatoxin induced hepatocyte injury, relates to the technical field of biological medicines, and has the technical key points that a specific mechanism of alpha-AMA induced hepatocyte injury is explored in detail, and a ferroptosis inhibitor fer-1 can be used for preparing a medicine for treating alpha-amatoxin poisoning. Important theoretical basis and experimental basis are provided for developing a new treatment strategy, so that new hope and possibility are brought for preventing and treating alpha-AMA poisoning.
Owner:KUNMING MEDICAL UNIVERSITY

Use of verbascoside for the preparation of a medicament for the treatment of obesity and related metabolic disorders

PendingCN122272608ALow density lipoprotein cholesterolPhosphorylation
This invention discloses the application of verbascoside in the preparation of drugs for treating obesity and related metabolic disorders, relating to the field of biopharmaceuticals. The drug upregulates the expression of phosphorylated AMP-activated protein kinase α and carnitine palmitoyltransferase-1α, while downregulating the expression of sterol regulatory element-binding protein-1c, fatty acid synthase, and acetyl-CoA carboxylase. This application is the first systematic study of the comprehensive intervention effect of verbascoside on diet-induced obesity and related metabolic disorders. In an in vivo obese mouse model, it was demonstrated that verbascoside can significantly inhibit excessive weight gain induced by a high-fat diet, reduce fasting blood glucose and fasting insulin levels, improve dyslipidemia indicators including triglycerides, total cholesterol, non-esterified fatty acids, and low-density lipoprotein cholesterol, enhance insulin sensitivity, and alleviate macrovesicular steatosis and hepatocellular damage.
Owner:XINJIANG UNIVERSITY

A renormane type diterpene, its preparation method and hepatoprotective use

PendingCN122255090AHepatoprotective activity hasdamage reliefOrganic active ingredientsOrganic chemistryHepatoprotective DrugsCinnamomum
The application discloses a rhynoxanthine type diterpene and a preparation method and application thereof; the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia, and has at least one of structural formulae as shown in formula (I), formula (II) and formula (III); the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia in the Lauraceae Cinnamomum plant; the application uses an alcohol, palmitic acid and other induced liver cell damage models to evaluate hepatoprotective activity, finds that the rhynoxanthine type diterpene can effectively relieve alcohol, palmitic acid and other induced liver cell damage, and indicates that the rhynoxanthine type diterpene has hepatoprotective activity, can be used for preparing hepatoprotective drugs, and has a good research and development prospect.
Owner:JINAN UNIVERSITY

Wheat peptide as well as preparation method and application thereof in anti-oxidation and anti-inflammatory aspects

PendingCN121159624ADipeptide ingredientsComponent separationDipeptideLIVER CELL DAMAGE
The invention belongs to the technical field of plant peptides, and particularly relates to a wheat peptide as well as a preparation method and application thereof in the aspects of oxidation resistance and inflammation resistance. According to the present invention, the peptide fragment structure of the wheat peptide is determined, the wheat peptide contains at least 85 peptide fragments, and dipeptide, tripeptide and other small molecule peptides are mainly adopted; meanwhile, tests find that the wheat peptide has smaller molecular weight than wheat protein, is easily absorbed by human bodies, and has better thermal stability and a tighter structure. Based on the structural characteristics of the wheat peptide, the invention confirms the biological activities of the wheat peptide and the characteristic peptide fragments FQ, FV and FA in the wheat peptide in the aspects of oxidation resistance and inflammation resistance, so that the wheat peptide has a very good protection effect on alcohol-induced hepatocyte injury. Therefore, the novel wheat peptide and the characteristic peptide fragment with antioxidant and anti-inflammatory activity are developed, the types of the wheat peptide are enriched, and a technical support is provided for further application of the wheat peptide.
Owner:CHINA NAT RES INST OF FOOD & FERMENTATION IND CO LTD

Application of plant extract sweet orange flavone in prevention and treatment of acute liver injury and protection of liver

The invention provides application of plant extract sweet orange flavone in prevention and treatment of acute liver injury and protection of liver. Research finds that the sweet orange flavone can effectively reduce ALT and AST levels of acute liver injury model mice, inhibit liver cell inflammatory response and reduce liver cell injury. The invention further finds that the sweet orange flavone can improve the acute liver injury by inhibiting the expression of the p-NF-kappa B-p65 protein. Therefore, the sweet orange flavone can be used as a medicine for preventing and treating acute liver injury and acute liver injury related diseases, can protect the liver, has the advantages of definite components, controllable quality, good curative effect and the like, and has a good application prospect.
Owner:GUANGDONG PHARMA UNIV

Composition comprising tetraarsenic hexaoxide as active ingredient for treating or preventing metabolic dysfunction-associated fatty liver disease

The present invention relates to a pharmaceutical composition comprising tetraarsenic hexaoxide as an active ingredient for treating or preventing metabolic dysfunction-associated fatty liver disease. The pharmaceutical composition according to the present invention significantly alleviates hepatocyte damage and inflammation and ameliorates metabolic dysfunction-associated fatty liver diseases including MASH and steatosis-related complications including obesity, thereby being able to treat and prevent metabolic dysfunction-related fatty liver diseases including MASH.
Owner:MEDPACTO INC +1

Application of plant extract dauricine in prevention and treatment of acute liver injury and protection of liver

The invention provides application of a plant extract dauricine in prevention and treatment of acute liver injury and protection of liver. Research finds that dauricine can effectively improve the liver function of an acute liver injury model mouse, reduce the liver cell damage and inflammation level, improve the oxidative stress state of liver cells and enhance the migration ability of the liver cells. Therefore, the dauricine can be used as a medicine for preventing and treating the acute liver injury and diseases related to the acute liver injury and protecting the liver, and has the advantages of definite components, controllable quality, good curative effect and the like.
Owner:GUANGDONG PHARMA UNIV

Polypeptide for treating liver fibrosis as well as synthesis method and application thereof

The invention discloses a polypeptide for treating liver fibrosis as well as a synthesis method and application thereof. The amino acid sequence of the polypeptide is as shown in the specification: YGRKKRRQRRRFSLDKIYLIGGDLGPFNPGLPVEV PLWLAI, and the amino acid sequence of the polypeptide is as shown in the specification. The synthesis method of the polypeptide can be an Fmoc solid-phase synthesis method. The polypeptide can effectively inhibit the liver fibrosis process and relieve liver cell injury, and can be used for preparing medicines for treating or preventing liver fibrosis diseases.
Owner:THE FIRST AFFILIATED HOSPITAL OF GUANGXI MEDICAL UNIVERSITY

A rose essential oil, composition, use

The application provides a rose essential oil, a composition and application, and belongs to the technical field of hepatocyte repair, and comprises the following steps: putting rose flowers and water into a distillation kettle, preheating by steam, performing vacuum distillation after reaching a predetermined temperature, and maintaining the temperature of an oil-water separator to obtain rose essential oil; a rose essential oil composition comprises the rose essential oil, and the rose essential oil accounts for 2-7% of the mass of the composition. The application also provides a rose essential oil for preparing a liver medicine, and the rose essential oil is used for repairing hepatocyte damage. The application realizes the development of natural medicine for the application of hepatocyte repair.
Owner:QILU NORMAL UNIV

Traditional Chinese medicine micromolecule composition and application thereof in preparation of medicine for treating metabolism-related fatty liver disease

The invention belongs to the technical field of biological medicines, and relates to a traditional Chinese medicine micromolecule composition and application thereof in preparation of medicines for treating metabolism-related fatty liver diseases. Through combined use of two or more of naringin, sophoriol, 8-isopentenyl naringenin and butene-7-O-beta-D-glucopyranoside, especially combined use of the four components, weight gain of MAFLD mice induced by high-fat diet / high-fat and high-sugar diet can be significantly reduced, lipid accumulation in the liver is reduced, and the weight loss of the mice is reduced. The insulin resistance is relieved, and the hepatocyte injury is improved. The composition can improve blood biochemical indexes related to lipid metabolism, relieve oxidative stress, increase fat consumption and improve a metabolic mode, and the effect is superior to that of a western medicine rosuvastatin positive control group and that of a western medicine rosuvastatin single use group.
Owner:SHANDONG UNIV

Ganoderma lucidum spore oil as well as preparation method, detection method and application thereof

The invention provides ganoderma lucidum spore oil as well as a preparation method, a detection method and application thereof, and the ganoderma lucidum spore oil is prepared by adopting a three-phase separation and extraction method: suspending ganoderma lucidum spore powder by 10mL of 50% ammonium sulfate, adding a tert-butyl alcohol solution according to a material-liquid ratio of 1: 15, uniformly mixing, adjusting the pH value of the suspension to 5, performing ultrasonic-assisted extraction for 30 minutes, extracting for 2.5 hours in an oscillating water bath kettle at 50 DEG C, centrifuging for 15 minutes by 10000 g, and performing vacuum filtration to obtain the ganoderma lucidum spore oil. Dividing into three layers, taking the upper layer, carrying out rotary evaporation to remove tert-butyl alcohol, blowing with nitrogen until no alcohol smell exists, and weighing to obtain the ganoderma lucidum spore oil extraction rate; according to the detection method, the compounds in the ganoderma lucidum spore oil can be accurately and quantitatively detected, the ganoderma lucidum spore oil rich in triterpenic acid, fatty acid and ergosterol can be extracted through the three-phase separation and extraction method, and the ganoderma lucidum spore oil has a remarkable hepatocyte injury resisting effect.
Owner:HAIHE LABORATORY OF MODERN CHINESE MEDICINE +1

LncLRFIF and application thereof in preparation of medicine for treating fatty liver hemorrhage syndrome of laying hens

The present application relates to the field of biological medicine, and particularly relates to lncLRFIF and application thereof in preparation of a medicine for treating laying hen fatty liver hemorrhagic syndrome.The present application provides lncLRFIF, and it is found for the first time that lncLRFIF can be used for preparation of a medicine for treating laying hen fatty liver hemorrhagic syndrome.In specific embodiments of the present application, lncLRFIF is knocked down by siRNA, so that the activities of ALT and AST in supernatant of chicken primary hepatocytes under FFAs treatment are recovered, lipid droplet accumulation and TG and T-CHO contents are significantly reduced, lipid synthesis is increased, lipid transport is increased, mitochondrial ATP and ROS contents are increased, and mitochondrial respiration and function are recovered.It can be seen that lncLRFIF can improve liver cell damage caused by FFAs and regulate lipid metabolism.The present application enriches the pathogenesis of laying hen fatty liver hemorrhagic syndrome, and provides a new idea for improving poultry egg production performance.
Owner:JIANGXI AGRICULTURAL UNIVERSITY

Use of levorotatory polylactic acid and its copolymer in preparation of products for bidirectional regulation of blood sugar and improvement of insulin resistance

This invention belongs to the field of pharmaceutical technology and relates to the application of polylactic acid (PLA) and its copolymers in the preparation of products that bidirectionally regulate blood glucose and improve insulin resistance. Specifically, this invention relates to the use of polymers in the preparation of pharmaceuticals, said polymers comprising PLA or copolymers containing repeating PLA units, wherein the repeating PLA units are...; the pharmaceuticals are used for one or more of the following purposes: bidirectional regulation of blood glucose, improvement of insulin resistance, protection of mitochondrial function, repair of nervous system damage, inhibition of liver inflammatory responses, and reduction of hepatocyte damage.
Owner:CHANGCHUN SINOBIOMATERIALS CO LTD

Determination method for hangover-alleviating and liver-protecting effects of hangover-alleviating and liver-protecting drink on mice with alcoholic liver injury

The invention relates to the technical field of prevention and treatment of alcoholic liver injury, and discloses a method for determining the hangover alleviating and liver protecting effects of a hangover alleviating and liver protecting drink on a mouse with alcoholic liver injury, and the method comprises the following steps: S1, preparing an extract; s2, establishing an animal model; s3, performing a drug experiment; s4, detecting experimental indexes; according to the alcohol effect dispelling and liver protecting drink, through compound compatibility of the radix puerariae, the hovenia dulcis thunb and the dendrobium officinale, key links of alcohol metabolism are comprehensively regulated and controlled, accumulation of liver tissue lipid peroxidation products (such as MDA) is remarkably reduced, triglyceride metabolic disorder can be improved, and the alcohol effect dispelling and liver protecting drink has the effects of dispelling the effects of alcohol and protecting liver. Liver cell injury is relieved through oxidative injury and lipid accumulation, the treatment effect is enhanced, and compared with a single-component medicine, the compound shows a more comprehensive substantive liver protection effect.
Owner:ZHONGJIAN LIAN SANDAO PHARMACEUTICAL (GUANGDONG) CO LTD

Use of gaoyao-4 powder in preparation of a medicine for treating or preventing acute alcoholic liver

The application provides application of Gao Yao-4 medicine powder in preparation of a medicine for treating or preventing acute alcoholic liver, and belongs to the field of medicine. It is found for the first time that the drugs in the Gao Yao-4 medicine powder have a combined effect, can effectively reduce the content of AST, ALT and TBIL in serum and liver tissue after a large amount of drinking, effectively reduce the content of TC, TG, MDA, TNF-alpha, IL-1beta and IL-6 in liver tissue after a large amount of drinking, improve the content of SOD, reduce the apoptosis rate of liver tissue cells, improve the expression amount of Bc1-2 protein, and reduce the expression amount of Bax, caspase3 and C-caspase3 protein, and has a repairing and protecting effect on alcoholic liver cell damage. It is shown that the Gao Yao-4 medicine powder can be used for treating / preventing acute alcoholic liver damage, and does not have side effects, and has high safety.
Owner:ALXA LEFT BANNER TRADITIONAL CHINESE MEDICINE & MONGOLIAN MEDICINE HOSPITAL