48 results about "LIVER CELL DAMAGE" patented technology

The invention belongs to but is not limited to the technical field of biomedicine, and discloses application of golden amide alcohol ester to preparation of a medicine for treating cholestasis. The in-vitro cell level verifies that the golden amide alcohol ester has relatively strong activity of activating FXR and CAR. The golden amide alcohol ester can relieve the cholestasis symptom of a cholestasis model mouse. The golden amide alcohol ester can obviously reduce the content of total bile acid and bilirubin in cells, relieve cholestasis and relieve hepatocyte damage. The golden amide alcohol ester can regulate and control the protein level of transporters and metabolic enzymes related to bile acid and bilirubin through double excitation of FXR and CAR, relieve cholestasis and achieve the purposes of benefiting gallbladder and removing jaundice.

The invention provides an application of a composition containing a sweet osmanthus extract in preparation of a product for improving liver functions and relieving liver injury. The preparation method comprises the following specific steps: (1) naturally drying sweet osmanthus in the shade, crushing, sieving, soaking in ultrapure water, carrying out suction filtration, and collecting a sweet osmanthus extracting solution; and (2) carrying out rotary evaporation on the osmanthus fragrans extracting solution in the step (1) until yellow syrup-shaped liquid is formed, so as to form an osmanthus fragrans concentrated solution, freezing, and carrying out vacuum drying, so as to obtain the osmanthus fragrans extract. According to the composition containing the osmanthus fragrans extract, ROS and MDA indexes in liver cells damaged by DBP can be reduced, reduction of GSH indexes is relieved, meanwhile, inflammatory indexes NF-kappa B, TNF-alpha and IL-6 are reduced, it is indicated that the composition containing the osmanthus fragrans extract has the capacity of inhibiting oxidative stress and inflammation in the damaged liver cells, and the composition containing the osmanthus fragrans extract has the advantages of being capable of being used for preventing and treating liver injury. Liver function impairment caused by DBP can be remarkably relieved, the application prospect is good, and practical significance is achieved.

The invention discloses a cadinane type sesquiterpene as well as a preparation method and application thereof. The cadinane type sesquiterpene is separated from cinnamon bark, and has at least one of structural formulas shown as a formula (I), a formula (II), a formula (III) and a formula (IV). Liver protection activity evaluation is carried out by applying an alcohol-induced hepatocyte injury model, and it is found that the cadinane type sesquiterpene can effectively relieve alcohol-induced AML-12 hepatocyte injury; the dumarane sesquiterpenes can inhibit the alcoholic liver disease and relieve fat accumulation, so that the dumarane sesquiterpenes have the anti-alcoholic liver disease activity, can be applied to preparation of the anti-alcoholic liver disease drugs, and have good research and development prospects; belongs to the field of natural medicinal chemistry.

The invention discloses application of a compound AZD5718 in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. The compound AZD5718 can effectively improve hepatocyte damage and bile metabolism disorder caused by Mdr2 gene deletion, provides solid experimental data support for developing novel drugs for treating cholestatic liver diseases, is expected to provide differentiated therapeutic drug choices for clinic, and has important medical value and social significance.

The invention relates to the technical field of health food, in particular to a selenium tea ethanol dehydrogenase activating peptide composition as well as a preparation method and application thereof. A response surface method is adopted to optimize a TSE-PP preparation process, affinity ultrafiltration and LC-MS / MS technologies are utilized to screen ADH binding peptides, and the action mechanism of the ADH binding peptides is researched through molecular docking and animal experiments. Experiments prove that the TSE-PP can promote ethanol metabolism, relieve liver cell injury, inhibit inflammatory response, relieve oxidative stress and improve liver lipid accumulation, the high-dose use effect is more remarkable, and a scientific basis is provided for application of the TSE-PP in the food with the function of dispelling the effects of alcohol and the nutrition fortified product. The invention discloses the preparation process of the TSE-PP and the anti-alcohol and liver protection effects of the TSE-PP, meanwhile, the TSE-PP has good food processing characteristics, and a theoretical basis and an experimental support are provided for production and application of the TSE-PP in functional foods.

This invention relates to the use of a natural terpene compound in pharmaceuticals, said natural terpene compound having the structure shown in formula (I), and having the function of preparing a compound for the prevention or treatment of hypoxia-inducible factor-1. α Use in medicines for diseases associated with abnormally elevated activity. This invention has discovered that the compound possesses hypoxia-inducible factor-1. α It exhibits inhibitory activity, effectively suppressing macrophage inflammatory responses and hepatocyte damage. It also demonstrates significant protective function against lipopolysaccharide / galactosamine-induced acute liver injury in mice, and can be used as a lead compound for the preparation of new drugs or drugs for the prevention and treatment of acute liver injury.

The present invention relates to the field of biotechnology. The present invention relates to a bioactive polypeptide, which has the effect of protecting the liver. Specifically, the present invention provides a bioactive polypeptide molecule PGPIP derived from A2β-casein in cow's milk, and its amino acid sequence is Pro-Gly-Pro-Ile-Pro. The present invention has confirmed through in vitro and in vivo experiments that it can effectively reduce liver lipid accumulation and hepatocyte damage, providing a feasible direction for the treatment of liver diseases, especially the prevention and treatment of alcoholic fatty liver; this bioactive polypeptide also has great application potential in the fields of food and health products.

The application relates to the field of nanobiomedical technology, and particularly relates to application of polyethylene glycol modified black phosphorus nanosheets in prevention and treatment of acute liver injury. The polyethylene glycol modified black phosphorus nanosheets not only have a significant active oxygen scavenging capacity, but also have calcium ion chelation and buffering capacity, can simultaneously regulate intracellular oxidation-reduction homeostasis and calcium homeostasis, inhibit intracellular calcium overload, especially mitochondrial calcium overload, maintain mitochondrial function, and further reduce liver cell damage, apoptosis and inflammatory response, and play a liver protection role. The application finds that the black phosphorus nanosheets are used in calcium ion chelation and inhibition of cell calcium overload, and breaks through the limitation that the black phosphorus nanosheets are mainly used as active oxygen scavenging materials in the prior art. The material can also adsorb copper ions and realize radioactivity copper labeling without chelating agent, and can be used for liver enrichment tracing and integrated diagnosis and treatment application. The material has a significant protective effect on paracetamol-induced acute liver injury.

The invention belongs to the technical field of biological medicine, and relates to a novel application of endogenous substances in alcohol related liver disease (ALD). The invention proposes for the first time that an endogenous substance with regular concentration change in the ALD process can be used as a biomarker for auxiliary diagnosis and / or stage evaluation of ALD, the exogenous supplement of the endogenous substance has a prevention and treatment effect on ALD, and the endogenous substance has double values of being used as an excellent biomarker and an effective therapeutic agent. The substances include but are not limited to taurochenodeoxycholic acid (TCDCA), dehydroepiandrosterone sulfate (DHEA-S) and the like. Wherein the serum concentration of TCDCA is obviously increased along with disease progression, and the concentration of DHEA-S is obviously reduced. The diagnostic value of the substance on ALD is remarkably superior to that of a traditional liver injury marker, and ethanol-induced liver cell injury and mouse liver pathological change can be remarkably improved through exogenous supplementation. The invention provides a brand new strategy for accurate diagnosis and prevention of ALD.

The invention discloses a medicinal and edible composition with an effect of regulating fasting blood-glucose of type 2 diabetes and application of the medicinal and edible composition, and belongs to the field of medicinal and edible nutritional health-care foods. The medicinal and edible dual-purpose composition with the function of regulating and controlling fasting blood glucose of type 2 diabetes mellitus comprises the following components in parts by weight: 7-9 parts of radix puerariae, 3-5 parts of astragalus membranaceus, 2-4 parts of radix ophiopogonis and 1-3 parts of liquorice. Or 7-9 parts of radix puerariae, 3-5 parts of radix asparagi, 3-5 parts of radix rehmanniae and 1-3 parts of liquorice. All the raw materials of the medicinal and edible combined species are medicinal and edible substances, so that the medicinal and edible combined species have the medicinal effects of traditional Chinese medicines, are safer and lower in toxic and side effects, can effectively regulate and control fasting blood-glucose of type 2 diabetes, can remarkably improve liver cell injury, has a better protection effect on the liver, and is suitable for patients with type 2 diabetes to take for a long time.

The invention discloses application of an APOA gene in preparation of a medicine for relieving bovine liver cell injury caused by vomitoxin, and relates to the technical field of medicine preparation. The APOA gene refers to an APOA1 gene, an APOA2 gene and an APOA4 gene; the CDS sequence of the APOA1 gene is as shown in SEQ ID NO. 19; the CDS sequence of the APOA2 gene is as shown in SEQ ID NO. 20; and the CDS sequence of the APOA4 gene is as shown in SEQ ID NO. 21. According to the application of the APOA gene in preparing the medicine for relieving the bovine liver cell injury caused by the vomitoxin, a model for relieving the bovine liver cell injury caused by the vomitoxin is established by applying a leading medicine vitamin E; comprehensive analysis finds that the vitamin E regulates the cholesterol metabolic pathway by regulating the APOA gene level so as to play a role in protecting the liver cells of the dairy cow, and reveals that the medicines for relieving the bovine liver cell injury caused by the vomitoxin can be screened through the regulating effect of the compound on the APOA gene level.

The application discloses application of AML-12 exosomes in preparation of medicines for treating cholestatic liver injury, relates to the technical field of biological medicine, and discloses application of AML-12 cell-derived exosomes in preparation of medicines for preventing and treating ANIT-induced cholestatic liver injury; the treatment is manifested as reduction of alanine aminotransferase, aspartate aminotransferase and alkaline phosphatase levels in serum. The application proves that the AML-12 cell-derived exosomes have a significant treatment effect on ANIT-induced cholestatic liver injury, successfully opens up the application of the biological preparation in a brand-new disease field, and fills the blank of the prior art; through in-vivo experiments, it is proved that AML-12 exosome treatment can significantly reduce liver cell injury markers and alkaline phosphatase, a key index of cholestasis, in serum of ANIT model mice, and improve pathological injury of liver tissue, thereby constituting a complete curative effect evidence chain from function to morphology.

This application discloses the application of pyridostigmine in the preparation of drugs for the prevention and treatment of non-alcoholic fatty liver disease (NAFLD). Validation was conducted using animal models of NAFLD induced by three different etiologies: methionine-choline deficiency diet, high-fat diet, and leptin gene knockout. Pyridostigmine significantly improved vagal nerve activity in the model animals (e.g., improving high-frequency and baroreflex sensitivity in heart rate variability), effectively corrected serum lipid metabolism disorders (reducing LDL cholesterol), alleviated hepatocyte damage (reducing ALT and AST), and at the histopathological level, reduced hepatic steatosis, decreased inflammatory cell infiltration, and inhibited collagen deposition, thereby achieving the prevention and treatment of NAFLD.

The invention belongs to the technical field of fungal polysaccharide application, and particularly relates to a yellow-rose yellow-meat boletus polysaccharide as well as a preparation method and application thereof. The preparation method comprises the following steps: extracting crude polysaccharide from boletus rosea sporocarp through a water extraction and alcohol precipitation method, and then carrying out deproteinization, decoloration and DEAE-52 cellulose column chromatography separation and purification to obtain the purified polysaccharide BPP-1 of the boletus rosea water component. CCl4 is selected as an inducer of oxidative stress injury of the MIHA cells to construct a hepatic cell oxidative injury model, and the model is utilized to evaluate the protective effect of BPP-1 on CCl4-induced MIHA cell hepatic injury. The result shows that the BPP-1 reduces the release of ALT and AST, improves the GSH level and the SOD enzyme activity at the same time, inhibits the generation of a lipid peroxidation product MDA, and effectively reduces the damage of CCl4 to liver cells. The results show that BPP-1 has a certain protection effect on CCl4-induced hepatocyte injury, and BPP-1 may be a potential antioxidant and can alleviate oxidative injury of liver.

The invention discloses a carbon tetrachloride damage model construction and nutrition intervention evaluation method based on a three-dimensional liver chip, and belongs to the technical field of microfluidics and biological medicines. According to the method, an in-vitro bionic liver tissue model is constructed by utilizing a three-dimensional liver chip, liver cell injury is induced by perfusing carbon tetrachloride, on the basis, substances such as algae-derived extracellular vesicles are added for repairing intervention, and meanwhile, contrastive analysis is performed with a two-dimensional plate culture system. Results show that the secretion level and the function maintenance time of albumin, urea and the like of liver cells in a liver chip model are superior to those of two-dimensional culture, and after nutrient intervention is carried out, liver injury indexes such as ALT, AST and the like in the chip model are remarkably reduced, and the cell activity and the metabolic function are obviously recovered. The model can be used for evaluating the curative effect of nutrient substances on chemical liver injury, overcomes animal experiment species difference and two-dimensional culture limitation, provides an efficient and sensitive in-vitro research platform for medicine and nutrition function screening, and has wide application prospects and industrialization potential.

The invention provides application of dracocephalum moldavica total flavonoids in preparation of a medicine for preventing and / or treating heart failure with preserved ejection fraction, and belongs to the technical field of biological medicine. After a heart failure model mouse with reserved ejection fraction is constructed and dracocephalum moldavica general flavone is administrated, research finds that compared with an HFpEF model group mouse, the myocardial cell damage degree of the dracocephalum moldavica general flavone group mouse is obviously reduced, the myocardial hypertrophy is obviously reduced, and the myocardial hypertrophy is obviously reduced. The total flavonoids of dracocephalum moldavica can significantly reduce pathological cardiac hypertrophy and myocardial fibrosis of HFpEF model mice, improve cardiac diastolic function, and reduce the degree of liver cell injury and lipid metabolism imbalance, thereby preventing and / or treating heart failure with ejection fraction retention.

The invention discloses an anti-obesity Leuconostoc mesenteroides strain and an application thereof. According to the present invention, a Leuconostoc pseudomesenteroides CU270 strain capable of reducing cholesterol content and triglyceride content is separated and identified from fermented pickled vegetables, the strain is preserved in Guangdong Microbial Culture Collection Center on November 4, 2024, and the preservation number is GDMCC NO.65413. The invention further discloses a preparation method of the Leuconostoc pseudomesenteroides CU270 strain capable of reducing cholesterol content and triglyceride content. Researches show that the CU270 strain has strong acid resistance, cholate resistance and oxidation resistance, and can significantly reduce the content of cholesterol and triglyceride. An obese animal model research finds that the strain can relieve obesity, reduce blood fat and blood sugar levels, improve blood fat rise caused by high-fat diet and relieve liver cell injury caused by high-fat diet, has no toxic or side effect, and provides a new thought for treatment of anti-obesity diseases.

The invention belongs to the technical field of medicines, and discloses a biphenyl compound urolithin B pepper acid ester and application thereof in the aspect of liver injury resistance. In particular to application of a biphenyl compound urolithin B pepper acid ester extracted and separated from a Zhaxun medicinal material and an anti-liver injury aspect, and a preparation method of Urolite B pipronate is reported. The invention belongs to the technical field of medicine. A biological activity test shows that the compound Urolite B piperimate has the capability of remarkably improving the cell survival rate in an in-vitro hepatocyte injury model induced by paracetamol (APAP), which is higher than that of a positive control drug bicyclol, and can be used for preparing the anti-liver injury medicine.

The invention discloses application of solamargine in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. By simulating a classical Mdr2- / -mouse model of clinical cholestasis pathology, the solamargine is researched and proved to treat cholestatic liver injury by improving hepatocyte injury, bile duct dysfunction and bile metabolism disorder, and the solamargine shows good application potential in clinical treatment of cholestatic liver diseases.

The invention discloses application of a compound turtle shell liver softening tablet in preparation of a medicine for preventing and / or treating intrahepatic cholangiocarcinoma. The prevention and / or treatment of the intrahepatic cholangiocarcinoma is embodied in at least one of the following aspects: 1) reducing the liver weight of a patient with the intrahepatic cholangiocarcinoma; the invention relates to a pharmaceutical composition for treating intrahepatic cholangiocarcinoma, in particular to a novel pharmaceutical composition for treating intrahepatic cholangiocarcinoma, which has the advantages that the pharmaceutical composition can be used for treating intrahepatic cholangiocarcinoma, reducing liver cell injury and liver fiber hyperplasia of patients with intrahepatic cholangiocarcinoma, regulating cholangiocarcinoma-related protein pathways of the patients with intrahepatic cholangiocarcinoma and inhibiting cancer cell proliferation.

The invention relates to the field of biological medicine, in particular to lncLRFIF and application of the lncLRFIF in preparation of medicine for treating laying hen fatty liver hemorrhagic syndrome. The invention provides lncLRFIF. It is found for the first time that lncLRFIF can be used for preparing a medicine for treating the fatty liver hemorrhagic syndrome of laying hens. According to the specific embodiment of the invention, lncLRFIF is knocked down through siRNA, so that the activities of ALT and AST in the chicken primary hepatocyte supernatant treated by FFAs are recovered, lipid droplet accumulation and the content of TG and T-CHO are remarkably reduced, lipid synthesis is increased, lipid transport is increased, the content of ATP and ROS in mitochondria is increased, and mitochondrial respiration and functions are recovered. It can be seen that lncLRFIF can improve liver cell damage caused by FFAs and regulate lipid metabolism. The invention enriches the pathogenesis of the fatty liver hemorrhagic syndrome of laying hens, and provides a new idea for improving the egg laying performance of poultry.

The invention discloses an application of ferroptosis in alpha-amatoxin induced hepatocyte injury, relates to the technical field of biological medicines, and has the technical key points that a specific mechanism of alpha-AMA induced hepatocyte injury is explored in detail, and a ferroptosis inhibitor fer-1 can be used for preparing a medicine for treating alpha-amatoxin poisoning. Important theoretical basis and experimental basis are provided for developing a new treatment strategy, so that new hope and possibility are brought for preventing and treating alpha-AMA poisoning.

This invention discloses the application of verbascoside in the preparation of drugs for treating obesity and related metabolic disorders, relating to the field of biopharmaceuticals. The drug upregulates the expression of phosphorylated AMP-activated protein kinase α and carnitine palmitoyltransferase-1α, while downregulating the expression of sterol regulatory element-binding protein-1c, fatty acid synthase, and acetyl-CoA carboxylase. This application is the first systematic study of the comprehensive intervention effect of verbascoside on diet-induced obesity and related metabolic disorders. In an in vivo obese mouse model, it was demonstrated that verbascoside can significantly inhibit excessive weight gain induced by a high-fat diet, reduce fasting blood glucose and fasting insulin levels, improve dyslipidemia indicators including triglycerides, total cholesterol, non-esterified fatty acids, and low-density lipoprotein cholesterol, enhance insulin sensitivity, and alleviate macrovesicular steatosis and hepatocellular damage.

The application discloses a rhynoxanthine type diterpene and a preparation method and application thereof; the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia, and has at least one of structural formulae as shown in formula (I), formula (II) and formula (III); the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia in the Lauraceae Cinnamomum plant; the application uses an alcohol, palmitic acid and other induced liver cell damage models to evaluate hepatoprotective activity, finds that the rhynoxanthine type diterpene can effectively relieve alcohol, palmitic acid and other induced liver cell damage, and indicates that the rhynoxanthine type diterpene has hepatoprotective activity, can be used for preparing hepatoprotective drugs, and has a good research and development prospect.

The invention belongs to the technical field of plant peptides, and particularly relates to a wheat peptide as well as a preparation method and application thereof in the aspects of oxidation resistance and inflammation resistance. According to the present invention, the peptide fragment structure of the wheat peptide is determined, the wheat peptide contains at least 85 peptide fragments, and dipeptide, tripeptide and other small molecule peptides are mainly adopted; meanwhile, tests find that the wheat peptide has smaller molecular weight than wheat protein, is easily absorbed by human bodies, and has better thermal stability and a tighter structure. Based on the structural characteristics of the wheat peptide, the invention confirms the biological activities of the wheat peptide and the characteristic peptide fragments FQ, FV and FA in the wheat peptide in the aspects of oxidation resistance and inflammation resistance, so that the wheat peptide has a very good protection effect on alcohol-induced hepatocyte injury. Therefore, the novel wheat peptide and the characteristic peptide fragment with antioxidant and anti-inflammatory activity are developed, the types of the wheat peptide are enriched, and a technical support is provided for further application of the wheat peptide.

The invention provides application of plant extract sweet orange flavone in prevention and treatment of acute liver injury and protection of liver. Research finds that the sweet orange flavone can effectively reduce ALT and AST levels of acute liver injury model mice, inhibit liver cell inflammatory response and reduce liver cell injury. The invention further finds that the sweet orange flavone can improve the acute liver injury by inhibiting the expression of the p-NF-kappa B-p65 protein. Therefore, the sweet orange flavone can be used as a medicine for preventing and treating acute liver injury and acute liver injury related diseases, can protect the liver, has the advantages of definite components, controllable quality, good curative effect and the like, and has a good application prospect.

The present invention relates to a pharmaceutical composition comprising tetraarsenic hexaoxide as an active ingredient for treating or preventing metabolic dysfunction-associated fatty liver disease. The pharmaceutical composition according to the present invention significantly alleviates hepatocyte damage and inflammation and ameliorates metabolic dysfunction-associated fatty liver diseases including MASH and steatosis-related complications including obesity, thereby being able to treat and prevent metabolic dysfunction-related fatty liver diseases including MASH.

The invention provides application of a plant extract dauricine in prevention and treatment of acute liver injury and protection of liver. Research finds that dauricine can effectively improve the liver function of an acute liver injury model mouse, reduce the liver cell damage and inflammation level, improve the oxidative stress state of liver cells and enhance the migration ability of the liver cells. Therefore, the dauricine can be used as a medicine for preventing and treating the acute liver injury and diseases related to the acute liver injury and protecting the liver, and has the advantages of definite components, controllable quality, good curative effect and the like.

The invention discloses a polypeptide for treating liver fibrosis as well as a synthesis method and application thereof. The amino acid sequence of the polypeptide is as shown in the specification: YGRKKRRQRRRFSLDKIYLIGGDLGPFNPGLPVEV PLWLAI, and the amino acid sequence of the polypeptide is as shown in the specification. The synthesis method of the polypeptide can be an Fmoc solid-phase synthesis method. The polypeptide can effectively inhibit the liver fibrosis process and relieve liver cell injury, and can be used for preparing medicines for treating or preventing liver fibrosis diseases.

The application provides a rose essential oil, a composition and application, and belongs to the technical field of hepatocyte repair, and comprises the following steps: putting rose flowers and water into a distillation kettle, preheating by steam, performing vacuum distillation after reaching a predetermined temperature, and maintaining the temperature of an oil-water separator to obtain rose essential oil; a rose essential oil composition comprises the rose essential oil, and the rose essential oil accounts for 2-7% of the mass of the composition. The application also provides a rose essential oil for preparing a liver medicine, and the rose essential oil is used for repairing hepatocyte damage. The application realizes the development of natural medicine for the application of hepatocyte repair.