28 results about "LIVER CELL DAMAGE" patented technology

The invention discloses application of a compound AZD5718 in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. The compound AZD5718 can effectively improve hepatocyte damage and bile metabolism disorder caused by Mdr2 gene deletion, provides solid experimental data support for developing novel drugs for treating cholestatic liver diseases, is expected to provide differentiated therapeutic drug choices for clinic, and has important medical value and social significance.

This invention relates to the use of a natural terpene compound in pharmaceuticals, said natural terpene compound having the structure shown in formula (I), and having the function of preparing a compound for the prevention or treatment of hypoxia-inducible factor-1. α Use in medicines for diseases associated with abnormally elevated activity. This invention has discovered that the compound possesses hypoxia-inducible factor-1. α It exhibits inhibitory activity, effectively suppressing macrophage inflammatory responses and hepatocyte damage. It also demonstrates significant protective function against lipopolysaccharide / galactosamine-induced acute liver injury in mice, and can be used as a lead compound for the preparation of new drugs or drugs for the prevention and treatment of acute liver injury.

The application relates to the field of nanobiomedical technology, and particularly relates to application of polyethylene glycol modified black phosphorus nanosheets in prevention and treatment of acute liver injury. The polyethylene glycol modified black phosphorus nanosheets not only have a significant active oxygen scavenging capacity, but also have calcium ion chelation and buffering capacity, can simultaneously regulate intracellular oxidation-reduction homeostasis and calcium homeostasis, inhibit intracellular calcium overload, especially mitochondrial calcium overload, maintain mitochondrial function, and further reduce liver cell damage, apoptosis and inflammatory response, and play a liver protection role. The application finds that the black phosphorus nanosheets are used in calcium ion chelation and inhibition of cell calcium overload, and breaks through the limitation that the black phosphorus nanosheets are mainly used as active oxygen scavenging materials in the prior art. The material can also adsorb copper ions and realize radioactivity copper labeling without chelating agent, and can be used for liver enrichment tracing and integrated diagnosis and treatment application. The material has a significant protective effect on paracetamol-induced acute liver injury.

The invention belongs to the technical field of biological medicine, and relates to a novel application of endogenous substances in alcohol related liver disease (ALD). The invention proposes for the first time that an endogenous substance with regular concentration change in the ALD process can be used as a biomarker for auxiliary diagnosis and / or stage evaluation of ALD, the exogenous supplement of the endogenous substance has a prevention and treatment effect on ALD, and the endogenous substance has double values of being used as an excellent biomarker and an effective therapeutic agent. The substances include but are not limited to taurochenodeoxycholic acid (TCDCA), dehydroepiandrosterone sulfate (DHEA-S) and the like. Wherein the serum concentration of TCDCA is obviously increased along with disease progression, and the concentration of DHEA-S is obviously reduced. The diagnostic value of the substance on ALD is remarkably superior to that of a traditional liver injury marker, and ethanol-induced liver cell injury and mouse liver pathological change can be remarkably improved through exogenous supplementation. The invention provides a brand new strategy for accurate diagnosis and prevention of ALD.

The invention discloses a medicinal and edible composition with an effect of regulating fasting blood-glucose of type 2 diabetes and application of the medicinal and edible composition, and belongs to the field of medicinal and edible nutritional health-care foods. The medicinal and edible dual-purpose composition with the function of regulating and controlling fasting blood glucose of type 2 diabetes mellitus comprises the following components in parts by weight: 7-9 parts of radix puerariae, 3-5 parts of astragalus membranaceus, 2-4 parts of radix ophiopogonis and 1-3 parts of liquorice. Or 7-9 parts of radix puerariae, 3-5 parts of radix asparagi, 3-5 parts of radix rehmanniae and 1-3 parts of liquorice. All the raw materials of the medicinal and edible combined species are medicinal and edible substances, so that the medicinal and edible combined species have the medicinal effects of traditional Chinese medicines, are safer and lower in toxic and side effects, can effectively regulate and control fasting blood-glucose of type 2 diabetes, can remarkably improve liver cell injury, has a better protection effect on the liver, and is suitable for patients with type 2 diabetes to take for a long time.

The application discloses application of AML-12 exosomes in preparation of medicines for treating cholestatic liver injury, relates to the technical field of biological medicine, and discloses application of AML-12 cell-derived exosomes in preparation of medicines for preventing and treating ANIT-induced cholestatic liver injury; the treatment is manifested as reduction of alanine aminotransferase, aspartate aminotransferase and alkaline phosphatase levels in serum. The application proves that the AML-12 cell-derived exosomes have a significant treatment effect on ANIT-induced cholestatic liver injury, successfully opens up the application of the biological preparation in a brand-new disease field, and fills the blank of the prior art; through in-vivo experiments, it is proved that AML-12 exosome treatment can significantly reduce liver cell injury markers and alkaline phosphatase, a key index of cholestasis, in serum of ANIT model mice, and improve pathological injury of liver tissue, thereby constituting a complete curative effect evidence chain from function to morphology.

This application discloses the application of pyridostigmine in the preparation of drugs for the prevention and treatment of non-alcoholic fatty liver disease (NAFLD). Validation was conducted using animal models of NAFLD induced by three different etiologies: methionine-choline deficiency diet, high-fat diet, and leptin gene knockout. Pyridostigmine significantly improved vagal nerve activity in the model animals (e.g., improving high-frequency and baroreflex sensitivity in heart rate variability), effectively corrected serum lipid metabolism disorders (reducing LDL cholesterol), alleviated hepatocyte damage (reducing ALT and AST), and at the histopathological level, reduced hepatic steatosis, decreased inflammatory cell infiltration, and inhibited collagen deposition, thereby achieving the prevention and treatment of NAFLD.

The invention discloses a carbon tetrachloride damage model construction and nutrition intervention evaluation method based on a three-dimensional liver chip, and belongs to the technical field of microfluidics and biological medicines. According to the method, an in-vitro bionic liver tissue model is constructed by utilizing a three-dimensional liver chip, liver cell injury is induced by perfusing carbon tetrachloride, on the basis, substances such as algae-derived extracellular vesicles are added for repairing intervention, and meanwhile, contrastive analysis is performed with a two-dimensional plate culture system. Results show that the secretion level and the function maintenance time of albumin, urea and the like of liver cells in a liver chip model are superior to those of two-dimensional culture, and after nutrient intervention is carried out, liver injury indexes such as ALT, AST and the like in the chip model are remarkably reduced, and the cell activity and the metabolic function are obviously recovered. The model can be used for evaluating the curative effect of nutrient substances on chemical liver injury, overcomes animal experiment species difference and two-dimensional culture limitation, provides an efficient and sensitive in-vitro research platform for medicine and nutrition function screening, and has wide application prospects and industrialization potential.

The invention provides application of dracocephalum moldavica total flavonoids in preparation of a medicine for preventing and / or treating heart failure with preserved ejection fraction, and belongs to the technical field of biological medicine. After a heart failure model mouse with reserved ejection fraction is constructed and dracocephalum moldavica general flavone is administrated, research finds that compared with an HFpEF model group mouse, the myocardial cell damage degree of the dracocephalum moldavica general flavone group mouse is obviously reduced, the myocardial hypertrophy is obviously reduced, and the myocardial hypertrophy is obviously reduced. The total flavonoids of dracocephalum moldavica can significantly reduce pathological cardiac hypertrophy and myocardial fibrosis of HFpEF model mice, improve cardiac diastolic function, and reduce the degree of liver cell injury and lipid metabolism imbalance, thereby preventing and / or treating heart failure with ejection fraction retention.

The invention discloses application of solamargine in preparation of a medicine for preventing and / or treating cholestatic liver diseases, and belongs to the field of biological medicines. By simulating a classical Mdr2- / -mouse model of clinical cholestasis pathology, the solamargine is researched and proved to treat cholestatic liver injury by improving hepatocyte injury, bile duct dysfunction and bile metabolism disorder, and the solamargine shows good application potential in clinical treatment of cholestatic liver diseases.

The invention discloses application of a compound turtle shell liver softening tablet in preparation of a medicine for preventing and / or treating intrahepatic cholangiocarcinoma. The prevention and / or treatment of the intrahepatic cholangiocarcinoma is embodied in at least one of the following aspects: 1) reducing the liver weight of a patient with the intrahepatic cholangiocarcinoma; the invention relates to a pharmaceutical composition for treating intrahepatic cholangiocarcinoma, in particular to a novel pharmaceutical composition for treating intrahepatic cholangiocarcinoma, which has the advantages that the pharmaceutical composition can be used for treating intrahepatic cholangiocarcinoma, reducing liver cell injury and liver fiber hyperplasia of patients with intrahepatic cholangiocarcinoma, regulating cholangiocarcinoma-related protein pathways of the patients with intrahepatic cholangiocarcinoma and inhibiting cancer cell proliferation.

This invention discloses the application of verbascoside in the preparation of drugs for treating obesity and related metabolic disorders, relating to the field of biopharmaceuticals. The drug upregulates the expression of phosphorylated AMP-activated protein kinase α and carnitine palmitoyltransferase-1α, while downregulating the expression of sterol regulatory element-binding protein-1c, fatty acid synthase, and acetyl-CoA carboxylase. This application is the first systematic study of the comprehensive intervention effect of verbascoside on diet-induced obesity and related metabolic disorders. In an in vivo obese mouse model, it was demonstrated that verbascoside can significantly inhibit excessive weight gain induced by a high-fat diet, reduce fasting blood glucose and fasting insulin levels, improve dyslipidemia indicators including triglycerides, total cholesterol, non-esterified fatty acids, and low-density lipoprotein cholesterol, enhance insulin sensitivity, and alleviate macrovesicular steatosis and hepatocellular damage.

The application discloses a rhynoxanthine type diterpene and a preparation method and application thereof; the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia, and has at least one of structural formulae as shown in formula (I), formula (II) and formula (III); the rhynoxanthine type diterpene is separated from the bark of Cinnamomum cassia in the Lauraceae Cinnamomum plant; the application uses an alcohol, palmitic acid and other induced liver cell damage models to evaluate hepatoprotective activity, finds that the rhynoxanthine type diterpene can effectively relieve alcohol, palmitic acid and other induced liver cell damage, and indicates that the rhynoxanthine type diterpene has hepatoprotective activity, can be used for preparing hepatoprotective drugs, and has a good research and development prospect.

The invention provides application of plant extract sweet orange flavone in prevention and treatment of acute liver injury and protection of liver. Research finds that the sweet orange flavone can effectively reduce ALT and AST levels of acute liver injury model mice, inhibit liver cell inflammatory response and reduce liver cell injury. The invention further finds that the sweet orange flavone can improve the acute liver injury by inhibiting the expression of the p-NF-kappa B-p65 protein. Therefore, the sweet orange flavone can be used as a medicine for preventing and treating acute liver injury and acute liver injury related diseases, can protect the liver, has the advantages of definite components, controllable quality, good curative effect and the like, and has a good application prospect.

The present invention relates to a pharmaceutical composition comprising tetraarsenic hexaoxide as an active ingredient for treating or preventing metabolic dysfunction-associated fatty liver disease. The pharmaceutical composition according to the present invention significantly alleviates hepatocyte damage and inflammation and ameliorates metabolic dysfunction-associated fatty liver diseases including MASH and steatosis-related complications including obesity, thereby being able to treat and prevent metabolic dysfunction-related fatty liver diseases including MASH.

The invention provides application of a plant extract dauricine in prevention and treatment of acute liver injury and protection of liver. Research finds that dauricine can effectively improve the liver function of an acute liver injury model mouse, reduce the liver cell damage and inflammation level, improve the oxidative stress state of liver cells and enhance the migration ability of the liver cells. Therefore, the dauricine can be used as a medicine for preventing and treating the acute liver injury and diseases related to the acute liver injury and protecting the liver, and has the advantages of definite components, controllable quality, good curative effect and the like.

The invention discloses a polypeptide for treating liver fibrosis as well as a synthesis method and application thereof. The amino acid sequence of the polypeptide is as shown in the specification: YGRKKRRQRRRFSLDKIYLIGGDLGPFNPGLPVEV PLWLAI, and the amino acid sequence of the polypeptide is as shown in the specification. The synthesis method of the polypeptide can be an Fmoc solid-phase synthesis method. The polypeptide can effectively inhibit the liver fibrosis process and relieve liver cell injury, and can be used for preparing medicines for treating or preventing liver fibrosis diseases.

The application provides a rose essential oil, a composition and application, and belongs to the technical field of hepatocyte repair, and comprises the following steps: putting rose flowers and water into a distillation kettle, preheating by steam, performing vacuum distillation after reaching a predetermined temperature, and maintaining the temperature of an oil-water separator to obtain rose essential oil; a rose essential oil composition comprises the rose essential oil, and the rose essential oil accounts for 2-7% of the mass of the composition. The application also provides a rose essential oil for preparing a liver medicine, and the rose essential oil is used for repairing hepatocyte damage. The application realizes the development of natural medicine for the application of hepatocyte repair.

The invention belongs to the technical field of biological medicines, and relates to a traditional Chinese medicine micromolecule composition and application thereof in preparation of medicines for treating metabolism-related fatty liver diseases. Through combined use of two or more of naringin, sophoriol, 8-isopentenyl naringenin and butene-7-O-beta-D-glucopyranoside, especially combined use of the four components, weight gain of MAFLD mice induced by high-fat diet / high-fat and high-sugar diet can be significantly reduced, lipid accumulation in the liver is reduced, and the weight loss of the mice is reduced. The insulin resistance is relieved, and the hepatocyte injury is improved. The composition can improve blood biochemical indexes related to lipid metabolism, relieve oxidative stress, increase fat consumption and improve a metabolic mode, and the effect is superior to that of a western medicine rosuvastatin positive control group and that of a western medicine rosuvastatin single use group.

The present application relates to the field of biological medicine, and particularly relates to lncLRFIF and application thereof in preparation of a medicine for treating laying hen fatty liver hemorrhagic syndrome.The present application provides lncLRFIF, and it is found for the first time that lncLRFIF can be used for preparation of a medicine for treating laying hen fatty liver hemorrhagic syndrome.In specific embodiments of the present application, lncLRFIF is knocked down by siRNA, so that the activities of ALT and AST in supernatant of chicken primary hepatocytes under FFAs treatment are recovered, lipid droplet accumulation and TG and T-CHO contents are significantly reduced, lipid synthesis is increased, lipid transport is increased, mitochondrial ATP and ROS contents are increased, and mitochondrial respiration and function are recovered.It can be seen that lncLRFIF can improve liver cell damage caused by FFAs and regulate lipid metabolism.The present application enriches the pathogenesis of laying hen fatty liver hemorrhagic syndrome, and provides a new idea for improving poultry egg production performance.

This invention belongs to the field of pharmaceutical technology and relates to the application of polylactic acid (PLA) and its copolymers in the preparation of products that bidirectionally regulate blood glucose and improve insulin resistance. Specifically, this invention relates to the use of polymers in the preparation of pharmaceuticals, said polymers comprising PLA or copolymers containing repeating PLA units, wherein the repeating PLA units are...; the pharmaceuticals are used for one or more of the following purposes: bidirectional regulation of blood glucose, improvement of insulin resistance, protection of mitochondrial function, repair of nervous system damage, inhibition of liver inflammatory responses, and reduction of hepatocyte damage.

The application provides application of Gao Yao-4 medicine powder in preparation of a medicine for treating or preventing acute alcoholic liver, and belongs to the field of medicine. It is found for the first time that the drugs in the Gao Yao-4 medicine powder have a combined effect, can effectively reduce the content of AST, ALT and TBIL in serum and liver tissue after a large amount of drinking, effectively reduce the content of TC, TG, MDA, TNF-alpha, IL-1beta and IL-6 in liver tissue after a large amount of drinking, improve the content of SOD, reduce the apoptosis rate of liver tissue cells, improve the expression amount of Bc1-2 protein, and reduce the expression amount of Bax, caspase3 and C-caspase3 protein, and has a repairing and protecting effect on alcoholic liver cell damage. It is shown that the Gao Yao-4 medicine powder can be used for treating / preventing acute alcoholic liver damage, and does not have side effects, and has high safety.

The invention discloses application of black garlic polysaccharide in preparation of a medicine for preventing, improving / or treating alcoholic liver diseases, and belongs to the technical field of biological medicines. The invention discloses and verifies the obvious effect of the black garlic polysaccharide (BGPs) in the aspect of preventing and treating the alcoholic liver disease for the first time, the effect of the black garlic polysaccharide is equivalent to that of a medicine bifendate, and the black garlic polysaccharide can obviously reduce the abnormal rise of serum glutamic-pyruvic transaminase (ALT), glutamic oxalacetic transaminase (AST) and alkaline phosphatase (ALP) levels caused by alcohol exposure and effectively relieve liver cell damage. The invention provides a brand new material basis and a clear application direction for developing novel liver protection medicines or functional foods. Compared with some chemical synthetic medicines, the black garlic polysaccharide is derived from medicinal and edible black garlic, has the remarkable advantages of naturalness, safety and low toxic and side effects, and is more suitable for long-term prevention or adjuvant therapy.

Use of a fish swim bladder mucopolysaccharide in the preparation of a drug or dietary supplement for ameliorating liver injury. The fish swim bladder mucopolysaccharide can ameliorate pathological damages such as arsenic-induced hepatic sinusoid and central venous congestion, cytoplasmic vacuolization of liver cells, and inflammatory infiltration, can ameliorate arsenic-induced liver cell damage and necrosis, and liver tissue oxidative imbalance, and can also significantly up-regulate the relative expression level of antioxidation-related genes in liver tissues, down-regulate the relative expression level of detoxification-related genes, and alleviate arsenic-induced liver damage.

This invention relates to the fields of nanotechnology, food science, and biomedicine, specifically to a zein-pectin composite nanoparticle loaded with naringin, its preparation method, and its application. The method includes the following steps: (1) dissolving zein and naringin in an alcohol-water solution to obtain a first solution; dissolving pectin in water to obtain a second solution; (2) adding the first solution to the second solution under stirring conditions. The average diameter of the composite nanoparticles conforms to the size range of nanodelivery systems, exhibiting excellent colloidal stability even under extreme environmental conditions; it also possesses good intestinal permeability and improved gastrointestinal bioavailability, and demonstrates potent antioxidant activity in vitro; furthermore, in cell models, the composite nanoparticles effectively alleviated oxidative stress, reduced free fatty acid-induced hepatocyte damage, and regulated lipid metabolism.

This invention discloses the application of a renolane-type diterpenoid compound or a pharmaceutically acceptable salt thereof in the preparation of a drug for the prevention or treatment of liver disease; the renolane-type diterpenoid compound has at least one of the structural formulas shown in formulas (I), (II), (III), (IV), (V), and (VI); the renolane-type diterpenoid compounds of formulas (I) to (VI) can significantly alleviate alcohol-induced hepatocellular damage, and the renolane-type diterpenoid compounds of formulas (III) to (VI) can significantly alleviate palmitic acid-induced hepatocellular damage, indicating that the renolane-type diterpenoids of this invention have hepatoprotective activity and can be used to prepare hepatoprotective drugs, showing good research and development prospects. This invention belongs to the field of natural product chemistry.

The application belongs to the technical field of proteins, and relates to an anti-digestion peptide capable of relieving alcoholic liver injury, a preparation method and application of the anti-digestion peptide, and the amino acid sequence of the anti-digestion peptide is PIPFPR. The anti-digestion peptide can resist the degradation of gastrointestinal digestive enzymes and be absorbed by intestinal epithelial cells, can resist the decrease of cell viability, eliminate free radicals, resist ethanol-induced oxidative stress, and relieve liver cell injury. The application further provides a preparation method and application of the anti-digestion peptide capable of relieving alcoholic liver injury.