32 results about "Viral carditis" patented technology

The invention includes processes mainly for the treatment of a inflammatory diseases, such as inflammatory bowel disease, arthritis, atherosclerosis, asthma, allergy, inflammatory kidney disease, circulatory shock, multiple sclerosis, chronic obstructive pulmonary disease, skin inflammation, periodontal disease, psoriasis and T cell-mediated diseases of immunity, including allergic encephalomyelitis, allergic neuritis, transplant allograft rejection, graft versus host disease, myocarditis, thyroiditis, nephritis, systemic lupus erthematosus, and insulin-dependent diabetes mellitus. The processes involve treating a patient with a pharmaceutical composition containing an active ingredient that inhibits the activity of sphingosine kinase.

This invention relates to a cTnI monocloned antibody and its hybridoma cell system. The said monocloned antibody has high specificity sensitivity and is easily prepared. It can identify different antigenic determinants on amino acid peptide segments 28-42, so as to be used for preparation of kits for diagnosis of cardiac infarction, angina pectoris and myocarditis.

The invention discloses compounds having virus resistance and a composition thereof. The composition comprises one or more of the 13 compounds comprising 6'-O-caffeoyl deacetyl asperulosidic acid methyl ester. The compounds having virus resistance and the composition thereof can be extracted from plants and can also be prepared by synthesis. The composition comprising the compounds having virus resistance can prevent and treat viral infection-caused diseases such as influenza, myocarditis, conjunctivitis, viral pneumonia, encephalitis, leukemia, hepatitis B, hepatitis C, AIDS, genitourinary system infection, EB virus infection, human papillomavirus infection and cytomegalovirus infection. The composition can be prepared into an oral preparation, an injection, a spray, a subcutaneous injection and an anus suppository.

The present invention relates to the use of at least one Epac (Exchange Protein directly Activated by cAMP) antagonist for the manufacture of a medicament intended for the prevention or the treatment of pathologies selected from the list comprising cardiac hypertrophy, cardiac arrhythmias, valvulopathies, diastolic dysfunction, chronic heart failure, ischemic heart failure, and myocarditis.

The invention relates to a chitosan mucosal delivery system, and the invention comprises two components which are the target antigen nanoparticles and the mucosal adjuvant nanoparticles. The target antigen nanoparticle comprises chitosan and target antigen coding plasmid DNA; the mucosal adjuvant nanoparticle comprises chitosan and mucosal adjuvant coding plasmid DNA. The mucosal vaccine which is produced according to the mucosal delivery system comprises two components, a component is the chitosan-VP1 nanoparticle which is formed by the chitosan and the plasmid of the coding CVB3 structural protein VP1 and the other component is the chitosan-VP1 nanoparticle which is formed by the chitosan and the plasmid of the coding lymphocyte chemotactic factor. By using the mucosal delivery system to carry out the mucosal immunity, the secreting of CVB3 specific generalization IgG and intestinal tract SIgA is induced effectively, and the occurrence of the Coxsackie vital myocarditis is effectively prevented.

The invention provides a mucosal adjuvant. The mucosal adjuvant is prepared by copolymerization crosslinking compounding of oligo-chitosan and lymphotactin encoding plasmids. The invention also discloses a preparation method and a use of the mucosal adjuvant. When the mucosal adjuvant and a gene vaccine composed of chitosan or oligo-chitosan are synchronously dropped into a nasal cavity for immunization, coxsackievirus specific serum antibody and systemic (spleen and lymph glands) Th1-type immune responses are induced and especially, intestinal mucosa partially-reinforced specific-secretion-type sIgA and IFNgama+Th1 responses are induced, and thus a gene vaccine used with the mucosal adjuvant is obviously superior to an exposed gene vaccine and effectively prevents coxsackievirus-caused myocarditis. The mucosal adjuvant can be used as a novel mucosal vaccination adjuvant.

The application relates to a pestivirus, designated PMC virus, that is associated with porcine myocarditis syndrome, and the gene and protein sequences derived therefrom. The application further relates to detection methods, vaccine therapeutics, and diagnostic methods using the PMC virus or gene/protein sequences derived therefrom.

A health-care tea for the patients of myocarditis, neuroparalysis, diphtheria, etc is proportionally prepared from nepherite grains, parrosia leaf, ophiopogon root and dendrobium.

Preparation and application of line leaf inula flower lactone A for treating myocarditis having a structure of

The compound shows positive therapeutic activity against Coxsackie virus and significant dose dependent correlation. The line leaf inula flower lactone A prevents disease in mouse models of experimental autoimmune myocarditis and onset of the process by intraperitoneal injection of a dose of 20 mg/kg/d. When increased to 100 mg/kg/d, the line leaf inula flower lactone A shows positive therapeutic effect on EAM. Line leaf inula flower lactone A is used as the sole active ingredient and combined with a conventional pharmaceutical carrier in a drug for treating myocarditis, and the pharmaceutical composition may be in the form of tablets, dispersible tablets, mouth collapse tablets, retard tablets, capsule, soft capsule, dropping pill, granules, injection, powder injection, or aerosol.

The present invention relates to piperazine derivatives of formulae Ia, Ib, Ic and Id and their use to treat myocarditis.

where R^1a, R^1b, R², R³, R⁴, R⁵, R⁶, R⁹, R¹⁰ and Y are as defined herein.

Disclosed are novel indanone derivatives, pharmaceutically acceptable salts thereof or enantiomers, a preparation method thereof, and a pharmaceutical composition for the prevention or treatment of viral diseases, comprising the same as an active ingredient. The indanone derivatives have excellent inhibitory activity against picornaviruses including coxsackie-, entero-, echo-, Polio-, and rhinoviruses, as well as exhibiting low cytotoxicity, so that they can be useful as an active ingredient of a pharmaceutical composition for the prevention or treatment of viral diseases including poliomyelitis, paralysis, acute hemorrhagic conjunctivitis, viral meningitis, hand-foot-and-mouth disease, vesicular disease, hepatitis A, myositis, myocarditis, pancreatitis, diabetes, epidemic myalgia, encephalitis, flu, herpangina, foot-and-mouth disease, asthma, chronic obstructive pulmonary disease, pneumonia, sinusitis or otitis media.

The invention provides a medicament for treating myocarditis. The medicament comprises the following components in parts by weight: 15-25 parts of semen zizyphi spinosae, 15-28 parts of semen boitae, 6-12 parts of pulp of dogwood fruit, 8-15 parts of polygala tenuifolia, 8-12 parts of tuckahoe, 10-20 parts of mother-of-pearl, 8-15 parts of fructus aurantii, 6-12 parts of radix curcumae, 6-10 parts of radix bupleuri, 6-15 parts of chuanxiong rhizome and 6-15 parts of angelica. The medicament provided by the invention has the advantages and positive effects of good curative effect, short course of treatment and low cost, and brings good news to patients and families thereof.

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

The present invention provides a peptide at least partially derivable from human α-myosin which peptide and the use of such peptides for the prevention or suppression of autoantibody formation in myocarditis.