Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

32 results about "Viral carditis" patented technology

Myocarditis is most often due to a viral infection. Other causes include bacterial infections, certain medications, toxins, and autoimmune disorders. A diagnosis may be supported by an electrocardiogram (ECG), increased troponin, heart MRI, and occasionally a heart biopsy.

Prevention of myocarditis, abortion and intrauterine infection associated with porcine circovirus-2

Provided is a method for reducing viral load of porcine circovirus type 2 (PCV-2) in a pig by inducing an immune response against PCV-2 through the administration of an immunogenic composition comprising a PCV-2 antigen. A preferred antigen is a vector containing a PCV-2 nucleotide sequence. In a particularly preferred embodiment, the PCV-2 nucleotide sequence is ORF4, ORF13, or ORF4 and ORF13. In some embodiments, the immunogenic composition includes one or more additional pig pathogens.
Owner:MERIAL SAS +1

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS20060257420A1Effectively eliminate set and subsetTreating or preventing inappropriate autoimmune responsePeptide/protein ingredientsImmunoglobulinsAutoimmune diseaseApoptosis
The invention is related to peptide constructs, i.e., polypeptides obtained by linking together two or more peptides based on or derived from different molecules, which are useful in the treatment or prevention of autoimmune diseases, asthma, allergies, and host versus graft (or graft versus host) rejection, as well as to compositions containing same, methods for producing same and methods for using same; wherein the peptide constructs have the formula P1-x-P2 where P1 is a peptide associated with autoimmune disease, allergy, asthma, host-versus-graft rejection, myocarditis, diabetes, and immune-mediated disease, which binds to an antigen receptor on a set or subset of T cells; P2 is a peptide which will cause a Th2 directed immune response by the set or subset of T cells to which the peptide P1 is attached or which will bind to a T cell receptor which will cause the set or subset of T cells to which the peptide P1 is attached to initiate, but not complete, an immune response causing the set or subset of T cells to undergo anergy and apoptosis; and x is a direct bond or linker for covalently bonding P1 and P2.
Owner:CEL SCI CORP

Methods for the treatment and prevention of inflammatory diseases

The invention includes processes mainly for the treatment of a inflammatory diseases, such as inflammatory bowel disease, arthritis, atherosclerosis, asthma, allergy, inflammatory kidney disease, circulatory shock, multiple sclerosis, chronic obstructive pulmonary disease, skin inflammation, periodontal disease, psoriasis and T cell-mediated diseases of immunity, including allergic encephalomyelitis, allergic neuritis, transplant allograft rejection, graft versus host disease, myocarditis, thyroiditis, nephritis, systemic lupus erthematosus, and insulin-dependent diabetes mellitus. The processes involve treating a patient with a pharmaceutical composition containing an active ingredient that inhibits the activity of sphingosine kinase.
Owner:APOGEE BIOTECHNOLOGY CORP

Monoclone antibody against human cardiac troponin I and its use

This invention relates to a cTnI monocloned antibody and its hybridoma cell system. The said monocloned antibody has high specificity sensitivity and is easily prepared. It can identify different antigenic determinants on amino acid peptide segments 28-42, so as to be used for preparation of kits for diagnosis of cardiac infarction, angina pectoris and myocarditis.
Owner:FUDAN UNIV

Compounds having virus resistance and composition thereof

The invention discloses compounds having virus resistance and a composition thereof. The composition comprises one or more of the 13 compounds comprising 6'-O-caffeoyl deacetyl asperulosidic acid methyl ester. The compounds having virus resistance and the composition thereof can be extracted from plants and can also be prepared by synthesis. The composition comprising the compounds having virus resistance can prevent and treat viral infection-caused diseases such as influenza, myocarditis, conjunctivitis, viral pneumonia, encephalitis, leukemia, hepatitis B, hepatitis C, AIDS, genitourinary system infection, EB virus infection, human papillomavirus infection and cytomegalovirus infection. The composition can be prepared into an oral preparation, an injection, a spray, a subcutaneous injection and an anus suppository.
Owner:樊向德 +1

Preventing and/or treating cardiovascular disease and/or associated heart failure

InactiveUS20060009534A1Lower Level RequirementsBiocideSenses disorderZona glomerulosaIliac artery
Methods are provided for reducing copper values for, by way of example, treating, preventing or ameliorating tissue damage such as, for example, tissue damage that may be caused by (i) disorders of the heart muscle (for example, cardiomyopathy or myocarditis) such as idiopathic cardiomyopathy, metabolic cardiomyopathy which includes diabetic cardiomyopathy, alcoholic cardiomyopathy, drug-induced cardiomyopathy, ischemic cardiomyopathy, and hypertensive cardiomyopathy, (ii) atheromatous disorders of the major blood vessels (macrovascular disease) such as the aorta, the coronary arteries, the carotid arteries, the cerebrovascular arteries, the renal arteries, the iliac arteries, the femoral arteries, and the popliteal arteries, (iii) toxic, drug-induced, and metabolic (including hypertensive and / or diabetic disorders of small blood vessels (microvascular disease) such as the retinal arterioles, the glomerular arterioles, the vasa nervorum, cardiac arterioles, and associated capillary beds of the eye, the kidney, the heart, and the central and peripheral nervous systems, (iv) plaque rupture of atheromatous lesions of major blood vessels such as the aorta, the coronary arteries, the carotid arteries, the cerebrovascular arteries, the renal arteries, the iliac arteries, the fermoral arteries and the popliteal arteries, (v) diabetes or the complications of diabetes.
Owner:PHILERA NEW ZEALAND

Use Of An Antagonist Of Epac For Treating Human Cardiac Hypertrophy

The present invention relates to the use of at least one Epac (Exchange Protein directly Activated by cAMP) antagonist for the manufacture of a medicament intended for the prevention or the treatment of pathologies selected from the list comprising cardiac hypertrophy, cardiac arrhythmias, valvulopathies, diastolic dysfunction, chronic heart failure, ischemic heart failure, and myocarditis.
Owner:INST NAT DE LA SANTE & DE LA RECHERCHE MEDICALE (INSERM)

Traditional Chinese medicine composition for treating vital myocarditis

A traditional Chinese medicine composition for treating vital myocarditis is prepared by red rhodobryum, purslane, honeysuckle stem, folium ginkgo, valerian, peltate yam rhizome, oldenlandia diffusa, lily, tea tree roots, salvia miltiorrhiza and apocynum venetum. The composition can be clinically used for treating the vital myocarditis.
Owner:宣城吉思知识产权运营有限公司

Treatment of diseases caused by viral infection

A method of prophylactic and / or therapeutic treatment of a mammal for a disease that is caused by a Ljungan virus infection, such as Myocarditis, Cardiomyopathia, Guillain Barré Syndrome, and Diabetes Mellitus, Multiple Sclerosis, Chronic Fatigue Syndrome, Myasthenia Gravis, Amyothrophic Lateral Sclerosis, Dermatomyositis, Polymyositis, Spontaneous Abortion, Intrauterine Death, Preeclampsia, Sudden Infant Death Syndrome, Bell's (facial) paralysis, Addison's disease, and Pernicious anemia, is described. An antiviral compound effective against a Ljungan virus, such as a compound effective against a picornavirus, e.g. Pleconaril or a derivative thereof, is used for the preparation of a medicament for the treatment of a disease in a mammal that is caused by a Ljungan virus infection, to eliminate or inhibit proliferation of the virus in the mammal and at the same time prevent and / or treat the disease in the mammal. A composition for treatment of a mammal for a disease caused by Ljungan virus infection including an antiviral compound, antiserum, and an interferon. A method of treatment of a mammal for a disease caused by a Ljungan virus infection.
Owner:APODEMUS

Treatment of diseases caused by viral infection

A method of prophylactic and / or therapeutic treatment of a mammal for a disease that is caused by a Ljungan virus infection, such as Myocarditis, Cardiomyopathia, Guillain Barré Syndrome, and Diabetes Mellitus, Multiple Sclerosis, Chronic Fatigue Syndrome, Myasthenia Gravis, Amyothrophic Lateral Sclerosis, Dermatomyositis, Polymyositis, Spontaneous Abortion, Intrauterine Death, Preeclampsia, Sudden Infant Death Syndrome, Bell's (facial) paralysis, Addison's disease, and Pernicious anemia, is described. An antiviral compound effective against a Ljungan virus, such as a compound effective against a picornavirus, e.g. Pleconaril or a derivative thereof, is used for the preparation of a medicament for the treatment of a disease in a mammal that is caused by a Ljungan virus infection, to eliminate or inhibit proliferation of the virus in the mammal and at the same time prevent and / or treat the disease in the mammal. A composition for treatment of a mammal for a disease caused by Ljungan virus infection including an antiviral compound, antiserum, and an interferon. A method of treatment of a mammal for a disease caused by a Ljungan virus infection.
Owner:APODEMUS

Delivery system and application of chitosan mucosa compromising mucosal adjuvant

The invention relates to a chitosan mucosal delivery system, and the invention comprises two components which are the target antigen nanoparticles and the mucosal adjuvant nanoparticles. The target antigen nanoparticle comprises chitosan and target antigen coding plasmid DNA; the mucosal adjuvant nanoparticle comprises chitosan and mucosal adjuvant coding plasmid DNA. The mucosal vaccine which is produced according to the mucosal delivery system comprises two components, a component is the chitosan-VP1 nanoparticle which is formed by the chitosan and the plasmid of the coding CVB3 structural protein VP1 and the other component is the chitosan-VP1 nanoparticle which is formed by the chitosan and the plasmid of the coding lymphocyte chemotactic factor. By using the mucosal delivery system to carry out the mucosal immunity, the secreting of CVB3 specific generalization IgG and intestinal tract SIgA is induced effectively, and the occurrence of the Coxsackie vital myocarditis is effectively prevented.
Owner:FUDAN UNIV

Mucosal adjuvant and its preparation method and use

The invention provides a mucosal adjuvant. The mucosal adjuvant is prepared by copolymerization crosslinking compounding of oligo-chitosan and lymphotactin encoding plasmids. The invention also discloses a preparation method and a use of the mucosal adjuvant. When the mucosal adjuvant and a gene vaccine composed of chitosan or oligo-chitosan are synchronously dropped into a nasal cavity for immunization, coxsackievirus specific serum antibody and systemic (spleen and lymph glands) Th1-type immune responses are induced and especially, intestinal mucosa partially-reinforced specific-secretion-type sIgA and IFNgama+Th1 responses are induced, and thus a gene vaccine used with the mucosal adjuvant is obviously superior to an exposed gene vaccine and effectively prevents coxsackievirus-caused myocarditis. The mucosal adjuvant can be used as a novel mucosal vaccination adjuvant.
Owner:FUDAN UNIV

Methods and compositions for inhibiting progression to chronic cardiac failure

InactiveUS8710018B2Reducing ultimate sizeDamage often becomes progressiveBiocideCarbohydrate active ingredientsDiseaseRate limiting
Provided herein are methods and formulations for preventing or ameliorating progression to chronic heart failure subsequent to cardiac stress, including as a consequence of myocardial infarction (MI), coronary artery disease, hypertension, cardiomyopathy, myocarditis, valvular regurgitation, severe lung disease, and / or severe anemia of chronic disease, by administration of one or more rate-limiting precursors to the synthesis of ATP. In one embodiment the ATP precursor is a pentose selected from one or more of ribose, D-ribose, ribulose, xylitol, xylulose, and a 5-carbon precursor of ribose.
Owner:FOKER JOHN E

Novel compound, pharmaceutically acceptable salt or optical isomer thereof, method for preparing same, and pharmaceutical composition for prevention or treatment of viral diseases containing same as active ingredient

The present invention relates to a novel compound, to a pharmaceutically acceptable salt or optical isomer thereof, to a method for preparing same, and to a pharmaceutical composition for the prevention or treatment of viral diseases containing same as an active ingredient. The novel compound according to the present invention not only has low cytotoxicity but also has excellent antiviral activity against picornavirus such as coxsackievirus, enterovirus, echovirus, poliovirus and rhinovirus, and thus can be effectively used as a pharmaceutical composition for the prevention or treatment of viral diseases such as infantile paralysis, acute hemorrhagic conjunctivitis, viral meningitis, hand-foot-and-mouth disease, vesicular disease, hepatitis A, myitis, myocarditis, pancreatitis, diabetes, epidemic myalgia, encephalitis, cold, herpangina, foot-and-mouth disease, asthma, chronic obstructive pulmonary disease, pneumonia, sinus infection, or otitis media.
Owner:KOREA RES INST OF CHEM TECH +1

Pestivirus species

The application relates to a pestivirus, designated PMC virus, that is associated with porcine myocarditis syndrome, and the gene and protein sequences derived therefrom. The application further relates to detection methods, vaccine therapeutics, and diagnostic methods using the PMC virus or gene / protein sequences derived therefrom.
Owner:INTERVET INT BV

Line leaf inula flower lactone a and methods for preparing and using the same for treating myocarditis

Preparation and application of line leaf inula flower lactone A for treating myocarditis having a structure ofThe compound shows positive therapeutic activity against Coxsackie virus and significant dose dependent correlation. The line leaf inula flower lactone A prevents disease in mouse models of experimental autoimmune myocarditis and onset of the process by intraperitoneal injection of a dose of 20 mg / kg / d. When increased to 100 mg / kg / d, the line leaf inula flower lactone A shows positive therapeutic effect on EAM. Line leaf inula flower lactone A is used as the sole active ingredient and combined with a conventional pharmaceutical carrier in a drug for treating myocarditis, and the pharmaceutical composition may be in the form of tablets, dispersible tablets, mouth collapse tablets, retard tablets, capsule, soft capsule, dropping pill, granules, injection, powder injection, or aerosol.
Owner:SHANXI ZHENDONG LEADING BIOTECH CO LTD

Chemokine inhibiting piperazine derivatives and their use to treat myocarditis

The present invention relates to piperazine derivatives of formulae Ia, Ib, Ic and Id and their use to treat myocarditis. where R1a, R1b, R2, R3, R4, R5, R6, R9, R10 and Y are as defined herein.
Owner:BAYER SCHERING PHARMA AG +1

Drug for treatment of myocarditis

The invention discloses a drug for treatment of myocarditis, which is prepared by taking radix polygonati officinalis, winged euonymus twig, pepperweed seed, lobster sauce, buffalo horn, curcuma aromatica, radix bupleuri and rhizome chuanxiong as raw materials. The invention has good use effect, accurate curative effect and the effective rate of over 80%.
Owner:朱彬彬

Indanone derivatives, pharmaceutically acceptable salts or optical isomers thereof, preparation method for same, and pharmaceutical compositions containing same as active ingredient for preventing or treating viral diseases

Disclosed are novel indanone derivatives, pharmaceutically acceptable salts thereof or enantiomers, a preparation method thereof, and a pharmaceutical composition for the prevention or treatment of viral diseases, comprising the same as an active ingredient. The indanone derivatives have excellent inhibitory activity against picornaviruses including coxsackie-, entero-, echo-, Polio-, and rhinoviruses, as well as exhibiting low cytotoxicity, so that they can be useful as an active ingredient of a pharmaceutical composition for the prevention or treatment of viral diseases including poliomyelitis, paralysis, acute hemorrhagic conjunctivitis, viral meningitis, hand-foot-and-mouth disease, vesicular disease, hepatitis A, myositis, myocarditis, pancreatitis, diabetes, epidemic myalgia, encephalitis, flu, herpangina, foot-and-mouth disease, asthma, chronic obstructive pulmonary disease, pneumonia, sinusitis or otitis media.
Owner:KATHOLIEKE UNIV LEUVEN +1

Use of vanillic acid derivatives in the treatment of systemic autoimmune diseases

The invention discloses the application of the vanillic acid derivatives represented by the formula (I) in the preparation of medicines for treating systemic autoimmune diseases. Preferred systemic autoimmune diseases are selected from systemic lupus erythematosus, rheumatoid arthritis, systemic sclerosis, Sjogren syndrome, polymyositis.
Owner:INST OF MATERIA MEDICA CHINESE ACAD OF MEDICAL SCI

Medicament for treating myocarditis

The invention provides a medicament for treating myocarditis. The medicament comprises the following components in parts by weight: 15-25 parts of semen zizyphi spinosae, 15-28 parts of semen boitae, 6-12 parts of pulp of dogwood fruit, 8-15 parts of polygala tenuifolia, 8-12 parts of tuckahoe, 10-20 parts of mother-of-pearl, 8-15 parts of fructus aurantii, 6-12 parts of radix curcumae, 6-10 parts of radix bupleuri, 6-15 parts of chuanxiong rhizome and 6-15 parts of angelica. The medicament provided by the invention has the advantages and positive effects of good curative effect, short course of treatment and low cost, and brings good news to patients and families thereof.
Owner:TIANJIN PACIFIC PHARMA

Crown monosodium glutamate glutamic acid ammonium selenide and preparation method thereof

The invention relates to a novel substance-crown monosodium glutamate glutamic acid ammonium selenide and a preparation method thereof. The preparation method comprises the following steps: (1) placing glutamic acid, ammonium carbonate and selenium oxide into a reaction container to obtain a mixture, and grinding the mixture to be subjected to solid-phase chemical reaction; (2) placing a reaction product into a drying oven after the mixture is adequately reacted, and heating the product at a constant temperature; and (3) cooling the product to the room temperature to obtain a product-glutamic acid ammonium selenide. The crown monosodium glutamate glutamic acid ammonium selenide is prepared from the glutamic acid, the ammonium carbonate and the selenium oxide. The glutamic acid is a main active ingredient of monosodium glutamate, so that the crown monosodium glutamate glutamic acid ammonium selenide also can be used as crown monosodium glutamate to be applied to the field of food flavoring, flavor enhancing and additives. In addition, the glutamic acid ammonium selenide also has an effect on supplementing the selenium, tonifying Yang and resisting the aging and can be widely used for preparing food and health products for preventing liver diseases, coma, impotence, cancers, hypertension, coronary heart diseases, myocarditis, Keshan diseases and Kaschin-Beck diseases.
Owner:李玉成

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS20060088544A1Effectively eliminate subsetDecrease and eliminate adverse effectPeptide/protein ingredientsDepsipeptidesCardiac myosinDisease
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP

Human myosin peptides

InactiveUS20190300573A1Improving left ventricular cardiac functionReduce spreadCompounds screening/testingPeptide/protein ingredientsMedicineViral carditis
The present invention provides a peptide at least partially derivable from human α-myosin which peptide and the use of such peptides for the prevention or suppression of autoantibody formation in myocarditis.
Owner:APITOPE INT

Medicine for treating myocarditis

A Chinese medicine for treating myocarditis, palpitation, angina pectoris, etc and preventing myocardiac infarction and cardiovascular and cerebrovascularinfarction is prepared from 14 Chinese-medicinal materials including rehmannia root, ginseng, red sage root, Chinese angelica root, etc.
Owner:倪文城
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More