229 results about "Order Scorpiones" patented technology

The invention discloses a preparing method of east Asia Tityus antibiotic peptide gene and appliance, which comprises the following steps: restructuring bacillus coli Escherichia coli DH5a / BmKAMP1, CCTCC NO: M207036; constructing east Asia Tityus ioterium cell cDNA library; choosing PCR method; sieving positive colony of scorpion antibiotic peptide gene from ioterium cDNA library; sequence-analyzing coding trait of antibiotic peptide gene; assuring amino acid sequence of the antibiotic peptide gene; adopting chemosynthesis antibiotic peptide; possessing inhibition of diverse density for Gram's bacterium. This antibiotic peptide possesses specificity and high active, which can be used as antibacterial drugs.

Surgical repair systems and techniques for plantar plate repairs. The surgical repair systems and methods reconstruct the plantar plate through a dorsal incision. The surgical repair system embodies a variety of instruments that provide visualization and access to the plantar plate using suture to complete the repair. The repair system may include some or all of the following instruments: a metatarsal head pusher employed in open surgical space, to move the “capital fragment” in a controlled manner; a suture retriever instrument and a suture retriever funnel (sleeve); a suture passer such as a Mini Scorpion DX and accompanying needle, or a variety of shaped Micro Suture Lassos; a measuring guide; and a small joint distractor.

The invention relates to a method for analyzing cytosine methylations in DNA sequences, according to which non-methylated cytosines are first converted into uracil while 5-methylcytosine remains unmodified. The DNA is then amplified by means of a polymerase and at least one primer whose 5 end is connected to a probe via a linker. The probe is intramolecularly hybridized onto the amplified products in accordance with the methylation state of the DNA, hybridization being detectable via different detection systems. The inventive method is particularly suitable for diagnosing and predicting cancer diseases and other diseases associated with a modification of the methylation state as well as for predicting undesired effects of medicaments.

The invention discloses a structure, function and making method of karsch analgesic antibiotic active peptide, whose amino acid sequence is NGYLLDKYTGCKVWCVINNESCNSECKIRGG-YYGYCYFWK LACFCQGARNSELWNYNTNKCNGKL, wherein the active peptide or derivant or analog can be synthesized through gene engineering technique, which solves the difficulty to separate and purify peptide; the active peptide is mixed with multiple carriers as medical acceptable agent, which is fit for clinical.

The invention relates to a quick scorpion raising method without hibernation, which belongs to the field of scorpion breeding methods. The quick scorpion raising method with the hibernation comprises the following steps: step 1) establishing breeding ground; step 2) feeding feed and supplying water; step 3) controlling the temperature and the humidity; step 4) managing a scorpion nest and the surrounding environment; step 5) carrying out mother-litter separation during the breeding season; step 6) managing and breeding litter scorpion; step 7) drying the scorpion for sale; and step 8) extracting toxin. The method can economically breed the scorpion within a relatively short period of time, provide a scorpion source for medical use and eating, have small investment and quickly produce the effects.

The invention discloses an ecological imitation indoor constant-temperature scorpion breeding method, comprising the following steps of: building a scorpion breeding farm; breeding scorpions, and controlling the feeding stuff, the temperature and the humidity to enable the scorpions to grow, develop and propagate, and enable baby scorpions to survive, wherein the feeding stuff adopts artificially bred yellow mealworms, Chinese polyphaga, asepsis flies or captured crickets, ants, woodlouses, earthworms and centipedes; the temperature is 32-35 DEG C; in the development process of the scorpions, the soil moisture content at the bottom of a scorpion breeding pool or a scorpion breeding basin is 25%-30%, and the relative air humidity of the scorpion breeding farm is 50%-60%. With the adoption of the scorpion breeding method, each mother scorpion can propagate about 50 scorpions in two times each year, the survival rate of the scorpions is more than 90%, and the death rate of the mother scorpions is reduced by 50%, so that time and labor are both saved, and the cost on breeding scorpions is reduced.

The invention discloses a preparing method of HaiNan speckle equal scorpion antibiotic peptide gene and appliance, which comprises the following steps: restructuring bacillus coli Escherichia coli DH5a / ImAMP1, CCTCC NO: M207034; constructing HaiNan speckle equal scorpion ioterium cell cDNA library; designing primer; choosing PCR method; sieving positive colony of scorpion antibiotic peptide gene from ioterium cDNA library; sequence-analyzing coding trait of antibiotic peptide gene; assuring amino acid sequence of the antibiotic peptide gene; adopting chemosynthesis antibiotic peptide; possessing inhibition of diverse density for Gram's bacterium. This peptide can be used to medicine to prevent and cure Gram's bacterium.

This invention discloses a method for preparing anti-tumor peptide of Buthus martensii, and its application. The method comprises: (1) screening cDNA sequence of anti-tumor peptide gene from cDNA library of Buthus martensii venom gland, designing primers, and performing PCR with the screened cDNA as a template to obtain anti-tumor peptide gene or gene fragment containing a digestion site of restriction endonuclease; (2) digesting the PCR product and expression plasmid; (3) ligating with T4 DNA ligase to obtain recombinant vector rBmKCTL / pGEX; (4) transferring into Eschericia coli BL21 to obtain engineering Eschericia coli BL21 / rBmKCTL / pGEX (CCTCC No. M206094). The method has such advantages as simple process, high safety, low cost, easy purification, and high product purity. The anti-tumor peptide can be used to manufacture drugs for preventing or treating tumor metastasis.

The scorpion breeding method in nature simulating condition includes providing cultivation pond with different temperature and humidity conditions for scorpion to select suitable inhabiting environment and adopting animal and plant complementing mode; providing composite feed including yellow meal worm, ground beetle, artificially compounded feed and molting hormone; and adopting loam and efflorescent wall soil as breeding soil. The present invention can raise the scorpion yield greatly.

The present invention relates to a kind of Chinese medicine for treating chronic granulocyte leukaemia and acute lymphocyte leukaemia. The Chinese medicine is prepared with 37 kinds of Chinese medicinal materials including long-noded pit viper, black-tail snake, glossy ganoderma, scorpion, bombyx batryticatus, and through crushing the materials into powder and other steps. The present invention has high curative effect ad no toxic side effect.

The invention relates to a Chinese medicine preparation for burning and scalding treatment. The technical proposal is that the invention is prepared with the following Chinese herbal ingredients by weight portion: sesame oil of 900 to 1500 portions, angelica of 20 to 28 portions, phellodendron of 20 to 28 portions, yellow wax of 20 to 28 portions, licorice of 20 to 28 portions, rhubarb of 20 to 28 portions, tiger stem of 6 to 12 portions, gromwell of 6 to 12 portions, scorpion of 3 to 6 portions, musk of 0.5 to 1.0 portions. The invention has the advantages of promoting local blood circulation, reducing infection on the scarface, being able to go through the shock period and the infection period steadily, and having an obvious effect.

The invention discloses a scorpion venom extract extracted from East Asia scorpions. A preparation method for the scorpion venom extract comprises the following steps: scorpion venom freeze-dried powder is dissolved, centrifuged, filtered by use of 0.45 mu m and 0.22 mu m microporous membranes and freeze-dried; sephadex is added in; III-IV protein peaks of scorpion venom are collected; cation exchange chromatography is carried out; detection is carried out by use of an ultraviolet spectrophotometer; and the protein peaks are collected, so as to obtain the scorpion venom extract. Experiments prove that the scorpion venom extract has definite functions of inhibiting angiogenesis and hepatoma cell reincrease value. The invention successfully extracts effective components inhibiting angiogenesis and hepatoma cell reincrease value from the East Asia scorpions, which provides a foundation for further research and application in the future.

The invention relates to medicinal liquor for treating rheumatic arthralgia and osteoarthrosis, which is prepared by soaking 20 to 30g of pubescent angelica root, 30 to 40g of divaricate saposhnikovia root, 5 to 30g of centipede, 5 to 30g of scorpion, 25 to 30g of long-noded pit viper, 15 to 20g of earthworm, 10 to 30g of Chinese polyphaga, 30 to 35g of schizophragma integrifolium, 20 to 30g of nux vomica, 30 to 35g of frankincense, 25 to 30g of myrrh, 30 to 35g of pedate pinallia jackinthepulpit rhizome, 20 to 30g of swordlike atractylodes rhizome, 15 to 25g of sargentgloryvine stem and 20 to 30g of cassia twig in each 1,000g of white spirit. The medicinal liquor has the effects of activating collaterals and relieving pain, dispelling wind and dampness, and relieving spasm and dissipating cold, can radically treat the osteoarthrosis such as the rheumatic arthralgia and the like and does not have any side or toxic effect.

The invention discloses a sea cucumber health-care wine and a brewing method thereof. On the basis of the white spirit as the base solution, the sea cucumber health-care wine contains the following raw materials in percentage by weight: 10-60% of sea cucumber enzymolysis solution, 1-20% of Chinese medicinal herb leaching solution, 0.1-0.5% of honey and the balance of water. The Chinese medicinal herb leaching solution is composed of 2-5 parts of acanthopanax bark, 3-8 parts of wolfberry fruit, 1-5 parts of angelica, 2-5 parts of scorpion, 2-7 parts of kudzu root, 1-3 parts of black ant and 4-8 parts of licorice. The brewing method comprises the following steps: cleaning sea cucumbers, boiling, carrying out enzymolysis, blending with the Chinese medicinal herb leaching solution subjected to soaking in white spirit and honey, and seasoning to obtain the sea cucumber health-care wine. The invention has the advantages of abundant nutrition, low nutrition loss of sea cucumbers in the preparation process, sufficient soaking of Chinese medicinal herbs, and favorable health-care function, has the effects of strengthening the constitution, tonifying the blood, moistening dryness, preventing cancers and relieving tiredness, and can be easily absorbed by the human body; and the invention is low in cost, and thus, is beneficial to popularization.

The invention discloses a novel scorpion breeding method, which comprises the following steps of: building a breeding land; adding feed and supplying water; controlling temperature and humidity; managing scorpion nests and surrounding environment; separating mother scorpions and son scorpions in the breeding season; managing and breeding the young scorpions; and drying and selling the scorpions. The novel scorpion breeding method can be used to economically and rapidly breed and feed the scorpions in a short time so as to provide medical and edible scorpion resources, the investment is small, and the produce effect is fast.

The invention discloses a method for producing recombinant scorpion toxin protein by adopting a silkworm as a parasitifer, which mainly comprises the following steps: adopting a scorpion cDNA as a template, adopting 5'-ACGTAGATCTATGGATGGATATATAAG-3' containing BglII enzyme cutting site as a forward primer and adopting 5'-ACGTAGATCT TTACTTTTTTCCAC-3' containing the BglII enzyme cutting site as a reverse primer to carry out PCR gene amplification reaction in 32 cycles to obtain a scorpion toxin gene; digesting pCR2.1-scorpion toxin by restriction endonuclease BglII to obtain a scorpion toxin gene fragment; cloning the scorpion toxin gene fragment in a baculovirus transfer vector pAcGP67b to obtain a recombinant pAcGP67b-scorpion toxin gene, carrying out homologous recombination with baculovirus BmNPV DNA of a silkworm in an insect cell by cotransfection to produce a recombinant virus; expressing in a silkworm body and purifying the recombinant scorpion toxin. Most of the recombinant scorpion toxin protein expressed by a silkworm larva is retained in a fat body of the silkworm; the scorpion toxin is purified from the fat body by an affinity chromatography; and the recombinant scorpion toxin has obvious biological toxicity, is suitable for the requirement of a biopharmaceutical industrialization level and has wide application prospect in the field of future medical and clinic treatment.

Compound prescription Bai Zhi paste and the preparation method involves a kind of medicine to treat the facial nerve paralysis, belongs to the Chinese native medicine domain.The invention provides a kind of curative effect paste, its raw material is composed by golden scorpion, system typhoneum giganteum, south system star, centipede, agkistrodon acutus, elevated gastrodia, dead silkworms, Sichuan, borneol and sesame oil.The paste producted in high temperature cooling oil, no destroyed medicine effective component, curative effect accurate to treat the facial nerve inflammation, the facial nerve lacking in vigilance, facial nerve convulsion, effect is satisfied, treatment course is short, does not have poisonous side effect, the use is convenient, does not need to heat and fire roast, is advantageous for the treatment at the spot.

The invention discloses methods for culturing and preserving syntrichia caninervis mitt. protonemata. The method for culturing syntrichia caninervis mitt. protonemata comprises the following steps: firstly selecting proper materials, carrying out washing, sterilizing, washing, air-drying, grinding and other treatments on the proper materials, then inoculating moss pieces to a BG11 solid culture medium, carrying out induction culture on the moss pieces in an illuminating incubator under the conditions that the temperature is 22 DEG C, the illumination intensity is 27mu mol.m<-2>.s<-1> and the light / dark time is 14h / 10h until the protonemata appear and then transferring the protonemata to liquid culture for progressive expanding propagation. The method for preserving syntrichia caninervis mitt. protonemata is characterized in that after being collected, the protonemata are naturally air-dried, are filled in sealed plastic bags and then are preserved at - 80 DEG C. The methods are beneficial to mass artificial expanding propagation of syntrichia caninervis mitt.; the protonemata can be developed into new plants, which provides a new way for artificial expanding propagation of syntrichia caninervis mitt.; and the methods have broad application fields.

The invention relates to a Chinese medicated liquor for curing cervical spondylosis. The Chinese medicated liquor is characterized in that 30-60 g of black-tail snakes, 30-45 g of safflower, 20-50 g of wild aconite root, 20-50 g of processed radix aconite, 20-50 g of dark plum, 20-50 g of honeysuckle flower, 50-100 g of kudzuvine root, 50-100 g of clematis root, 50-100 g of chaenomeles fruit slices and 6 to 10 scorpions are put in 1500 g of white liquor with 50 to 60 degrees, sealed and soaked for 7 days, and then filtered, and the filter liquor is the first dose of medicated liquor of the Chinese medicated liquor. The traditional Chinese medicine raw materials filtered out are soaked with 1000 g of the white liquor with 50 to 60 degrees for 15 days, and then are filtered to obtain the second dose of medicated liquor. The invention has the functions of relaxing muscle and activating the channels, expelling wind and removing numbness and promoting the blood circulation and relieving pain and is used for curing various cervical spondylosis.

The invention relates to a buthus martensi kirsch health liquid, wine and their preparing process, wherein the health liquid is prepared from the following raw materials (by weight ratio) through spirit lixiviating: buthus martensi kirsch 8-15%, ganoderma lucidum 6-11%, radix salvia miltiorrhiza 6-11%, matrimony vine 8-12%, cyathula root 8-12%, Ligusticum wallichii 8-12%, eucommia bark 6-12%, batryticated silkworm 8-12%, notoginseng 4-8%, Chinese angelica root 6-11%. The buthus martensi karsch health wine is further prepared through mixing the health liquid with spirit.

The invention discloses a plaster, and belongs to the technical field of application of traditional Chinese medicines. The plaster is prepared from the following raw medicines in parts by weight: 10-20 parts of toad skin, 15-30 parts of bungarus parvus, 15-30 parts of centipede, 15-30 parts of scorpion, 10-20 parts of pangolin scales, 5-15 parts of moschus, 15-30 parts of saussurea involucrate, 20-30 parts of pseudo-ginseng, 15-30 parts of frankincense, 15-30 parts of myrrh, 20-40 parts of dragon's blood, 20-40 parts of rhizoma cibotii, 20-40 parts of caulis spatholobi, 20-40 parts of common threewingnut root, 20-40 parts of radix aconiti, 20-30 parts of rhizoma gastrodiae, 20-30 parts of white mustard seed, 20-30 parts of fructus xanthii, 100-150 parts of minium and 800-1,000 parts of oleum sesami. The plaster has the significant advantages of being fast in effect, short in course of the treatment, remarkable in effect, low in cost and safe, free of toxic or side effect and the like.

Aquatect is an apparatus that consists of six building blocks that create a perfect, clean, and safe ecosystem for pets: herptiles (amphibians and reptiles), arthropods (spiders, insects, scorpions, and crustaceans), mollusks, and fish. The apparatus can be housed in aquarium tanks. The apparatus is constructed to replicate any ecosystem to accommodate any species listed above together or independently. The apparatus or blocks can also use different types of substrates to create various ecosystems. The ecosystem can be arid, tropical, humid, terrestrial, rocky, etc. to suit the needs of the species listed above. The ecosystem will be able to sustain life and suit the inhabitants. The apparatus or blocks are easily removable, and can be cleaned separately, so the ecosystem is not disturbed, or removed and cleaned all together. The blocks are not permanently adhered to the tank so they do not disrupt the integrity of the host tank. The apparatus is also unique because all the blocks work in union with each other and can be arranged in different configurations to create unique ecosystems. Aquatect gives a person total creativity to design a personal and unique ecosystem for their pet(s).

A tissue culture method for reproducing the scorpion-tail canna which has high appreciative value due to its shape and gay colours of its flower, its culture media and reproduction method, and the disinfecting method for its explant are disclosed. Its advantages are high speed and high effect.

An anti-arrhythmia scorpion peptide whose amino acid sequence is disclosed is prepared through designing PCR upstream primer containing enteric kinase cut site, using the PCR to amplify anti-arrhythmia peptide gene fragment through limited enzymatic cut of endoenzyme, clonining to pGX-5x-1 expression carrier, transferring to colibacillus BL21 to obtain recombinant colibacillus BL21 (pGEX / BmK1M); after inducing by IPTG, through purifying by glutathion transferase affinity chromatographic column, expressing the resultant fusion protein by enteric kinase and desalting to obtain the said peptide.Its advantages are high anti-arrhythmia activity, high solubility and high output.

The invention belongs to the field of economical animal cultivation, in particular to a method of improving the scorpion ecdysis speed and the ecdysis scorpion survival rate. The method comprises the following steps of according to the following mass proportions, taking 15-35% of plant straw particles, 5-15% of soil particles, 15-25% of coal ash particles, and the balance of saw dust particles; uniformly mixing the raw materials, and placing the mixed raw materials into a cave opening of a scorpion nest. The friction between oil skin and the outside is increased by the uniformly mixed particle raw materials when the scorpion is subjected to ecdysis, the separation speed of the body and the old skin is accelerated, the particle raw materials are accumulated in the cave opening of the nest under the instinct effect of the scorpion, the trace of the scorpion which is subjected to the ecdysis can be covered, and the probability that the scorpion which is subjected to the ecdysis is killed by other scorpions is reduced.

The present invention is directed to recombinant human antibodies specific for Cn2 toxin from C. noxius scorpion venom. The antibodies are able to recognize the toxin and preferably neutralize it as well as the whole venom of C. noxius scorpion. This invention is also directed to a human non-immune phage display library. One clone that specifically binds the Cn2 toxin was affinity matured by directed evolution. Three cycles of maturation were performed and several scFv clones were isolated which specifically recognize toxin Cn2 with increased Kd of 446 fold. All variants were monomeric and only variants 6009F, 6105F and 6103E showed to be capable of neutralizing toxin Cn2 and the whole venom. Variant 6009F recognizes a different epitope than that of BCF2, a murine monoclonal antibody raised against scorpion toxin Cn2 which is also capable of neutralizing both Cn2 toxin and the whole venom when tested in mice, as well as that of commercially available polyclonal antibody fragments antivenom from horse. The scFv 6009F is the first reported recombinant human antibody fragment capable of neutralizing a scorpion venom. These results pave the way for the generation of safer autologous recombinant neutralizing antivenom against scorpion stings. The antibodies of the present invention can be used as part of a composition to treat those in need of treatment including those already stung by one or more scorpions, particularly C. noxius scorpions.

The invention discloses a medicinal combination used for curing gilles de la tourettes syndromes, and a method for preparing the medicinal combination, which belongs to the field of a Chinese traditional medicine. The medicinal combination is prepared from uncaria, japanese sweetflag, oyster, magnet, scorpion, coptis, pawpaw, club moss, magnolia flower, chrysanthemum, and so on. Effective ingredients are extracted through wet distillation, decoction in water, or in ethanol and so on based on the different characteristics of the medicaments. Capsules, tablets, granules, powder, pills or oral are prepared in this way. The medicinal combination has the function of calming the endopathic wind and resolving phlegm, which shows specific and safe curative effects for gilles de la tourettes syndromes of children. The invention further discloses a method used for controlling the quality of the medicinal combination.

The invention discloses a detection kit for quickly identifying donkey skin, horse skin and mule skin, which is used for accurately identifying donkeys, horses, mules and jennets by creatively applying 16SrRNA genes of CKM (creatine kinase) karyogene (nDNA) and mitochondrial genome DNA (mtDNA) at the same time from genetic background of the horses, the donkeys and the mules. The kit adopts an molecular beacon probe (MB) method to carry out a quintuple multicolor fluorescence quantitative PCR (polymerase chain reaction) detection technology, and also can detect donkey, horse, mule and jennet components; and moreover, the kit is added with exogenous internal reference as an interior label, can detect and avoid false negative results produced by PCR inhibitor contained in a sample. The quintuple multicolor fluorescence quantitative PCR is used for detecting in the same tube without opening a cover, so that the detection kit is not easy to pollute, and is accurate and stable, simple to operate, extremely high in sensitivity, strong in specificity, and the like, and therefore, a novel way is explored for identifying the donkey skin, horse skin and mule skin.

The invention aims at providing medicine combination with the proportion of 150g of semen powder, 19g of olibanum (fried), 19g of myrrh (fried), 19g of scorpion, 19g of achyranthes root, 19g of atractylodes, 19g of ephedra and 19g of glycyrrhia. The medicine combination and excipient acceptable for pharmacy undergo the processes of reflux extraction, condensation, extract drying, grinding, granulation, pill making, capsule filling and tablet pressing to be made into acceptable preparation including a particle, an effervescent granule, a conventional tablet, the chewable tablet, the effervescent tablet, a capsule, the soft capsules and a pill, thus becoming the new preparation of Ma Qian tablet for rheumatic. The invention provides the new treating application of the medicine combination for cervical spondylosis, lumbar disc herniation, hyperosteogeny and femoral head necrosis (FHN).

The invention relates to a scorpion venom extractor, which comprises a base, a funnel collector, an ice box, an inner electroconductive net, an outer electroconductive net, a glass tube and a vibrator. The vibration of the vibrator in the glass tube and the smell of insect food in the glass tube are utilized to allure a scorpion, so that the scorpion can spontaneously extend the tail into the cell of the outer electroconductive net to touch the inner electroconductive net and thereby can be electrically shocked to discharge scorpion venom, and thereby the purpose of venom extraction is achieved.