Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

77results about How to "The detection process is fast" patented technology

A bimetallic nanocluster fluorescent probe compound and application thereof in preparation of a product for rapidly detecting acetylene

PendingCN122500188ADefine controllable preparation processesStable fluorescence lifetimeFluoProbesFluorescent quenching
The application belongs to the technical field of fluorescent probe detection, and discloses a bimetallic nanocluster fluorescent probe compound and application thereof in preparation of a product for rapidly detecting acetylene. The fluorescent probe compound is a gold-copper bimetallic nanocluster solution modified by adamantane thiol, which is used as a fluorescent probe for acetylene detection. The solution has a clear and controllable preparation process. Through specific proportioning and reaction conditions of cuprous chloride, adamantane thiol, tetrachloroauric acid, sodium borohydride and other reagents, a probe solution with stable fluorescence characteristics can be prepared. The bimetallic nanocluster fluorescent probe compound is applied in preparation of a product for rapidly detecting acetylene. Through specific combination of fluorescent molecules and acetylene gas to trigger the secondary effect of fluorescence quenching, detection is realized, and other substances cannot trigger quenching. At a wavelength of 700 nm, the linear relationship (R 2 >0.99) between the fluorescence intensity and the acetylene concentration realizes accurate quantification of the acetylene concentration, and the minimum detection limit is 0.026 muL / L.
Owner:SOUTHWEST UNIVERSITY FOR NATIONALITIES

Method for rapidly determining K.2. 2.2. 2 content in FDG card sleeve kit leacheate

The invention relates to a method for rapidly determining the content of K.2. 2.2. 2 in an FDG card sleeve kit leacheate, and belongs to the technical field of radiopharmaceutical analysis. The method comprises the following steps: selecting a 1110 + / -5 cm <-1 > peak as a quantitative characteristic peak of K.2.2. 2, wherein the peak corresponds to symmetric stretching vibration of a C-O-C ether bond in a K.2.2. 2 molecule; selecting a 2253 + / -3cm <-1 > peak as an internal standard peak, wherein the peak corresponds to C = N triple bond stretching vibration of acetonitrile in the leacheate; preparing a K.2. 2.2. 2 gradient solution with the concentration of 0.05 to 5 mg / mL, and fixing the concentration of K2CO3 to be 0.5 to 2 mg / mL; the method comprises the following steps: acquiring a spectrum by adopting an ATR technology, setting the resolution ratio to be 4cm <-1 > and the scanning frequency to be 32, and establishing a K.2. 2.2. 2 linear model according to the ratio of A1110 / A2253; eliminating baseline drift by adopting a second derivative spectrum; and a PLS algorithm is adopted to correct trace interference of K2CO3.
Owner:GUANGZHOU ATOM HIGH TECH RADIOPHARMACEUTICAL CO LTD

A monocular target object space parameter measurement method, system and medium based on a 2D camera

This invention relates to a method, system, and medium for measuring the spatial parameters of a monocular target object based on a 2D camera. The method includes: acquiring a calibration board image and an original distorted image captured by the 2D camera; calibrating the calibration board image using a calibration algorithm to obtain calibration parameters; correcting the original distorted image using the calibration parameters to obtain a corrected image; performing target detection; and outputting the external contour and target contour feature points of the target object; classifying the target contour feature points into upper boundary feature points and lower boundary feature points; calculating the relative distance between the target object and the 2D camera based on the lower boundary feature points and the calibration parameters; and performing curve fitting on the upper and lower boundary feature points and the lower boundary feature points, respectively, and calculating the actual height of the target object based on the calibration parameters. Compared with existing technologies, this invention has advantages such as improved measurement accuracy and adaptability to complex boundary targets.
Owner:DONGHUA UNIV

Primer probe combination, reagent, method and application for detecting brucella vaccine strain RB51

PendingCN122279068AQuick checkAccurate differential diagnosisForward primerBrucella Vaccine
This invention provides a primer-probe combination, reagents, methods, and applications for detecting Brucella vaccine strain RB51, belonging to the field of pathogen detection technology. The primer-probe combination for detecting Brucella vaccine strain RB51 of this invention includes a forward primer RB51-F, a reverse primer RB51-R, and a probe RB51-P; the forward primer RB51-F is shown in SEQ ID NO:1, the reverse primer RB51-R is shown in SEQ ID NO:2, and the probe RB51-P is shown in SEQ ID NO:3. The fluorescent PCR and digital PCR detection methods established based on the primer-probe combination of this invention have high sensitivity, good specificity, fast detection speed, and high throughput, enabling rapid detection of Brucella vaccine strain RB51, making differential diagnosis more accurate, economical, efficient, and convenient.
Owner:广西壮族自治区动物疫病预防控制中心(广西壮族自治区屠宰技术中心)

Hardness detection device for automobile die parts

The utility model discloses a hardness detection device for automobile die parts, which comprises a mounting base, a transverse moving assembly is arranged at the top of the mounting base, a placing plate is arranged at the top of the mounting base through the transverse moving assembly, and an L-shaped plate is fixedly arranged at the top of the mounting base. The adjusting assembly drives the mounting frame to move, the mounting frame drives the moving column and the pressure sensor to move, the moving column drives the ball to move, the detection position can be adjusted, the rotary lifting assembly drives the mounting plate to rotate, the adjusting assembly and the mounting frame move, and the mounting frame drives the moving column and the pressure sensor to move. And the balls are driven to move through the moving columns, so that the detection position can be adjusted again, the hardness of different positions of the automobile mold part can be detected, the situation that too much time is wasted due to the fact that the automobile mold part needs to be taken down and fixed again is avoided, and the detection speed of the hardness detection equipment is higher.
Owner:WUXI QI HI-TECH CO LTD

A cycling clothes quality detection device and a detection system thereof

This invention discloses a quality inspection device and system for cycling apparel, comprising: a workbench with an installation slot on its top; a cycling apparel inspection table detachably and fixedly installed in the installation slot, the top of which has a positioning slot for positioning the cycling apparel to be inspected; and a support assembly including a support frame fixedly installed on the top of the workbench. This invention relates to the field of quality inspection devices for cycling apparel. Through the collaborative operation of a visual camera, a main control chip, a wireless signal transmission module, a storage module, and a display screen, it achieves automatic identification of appearance defects in cycling apparel, real-time processing of inspection data, local storage, and remote transmission. This results in a significant reduction in the rate of missed inspections, a highly efficient and rapid inspection process, traceable and manageable data, and a significantly improved overall standardization of the inspection process.
Owner:QUANZHOU RUILI SPORTS GOODS CO LTD

KASP primer pairs, kits, methods and applications for detecting combinations of snps associated with soy protein content

ActiveCN121344250Bstability analysisStrong correlationMicrobiological testing/measurementDNA/RNA fragmentationBiotechnologyGermplasm
This invention provides KASP primer pairs, kits, methods, and applications for detecting SNP combinations related to soybean protein content. The SNP combinations related to soybean protein content include SNP1 at position 4903434 on chromosome Chr11, SNP2 at position 47558915 on chromosome Chr10, and SNP3 at position 47559046. This invention also provides three sets of KASP primer pairs for detecting SNP1, SNP2, and SNP3, used to detect soybean genetic DNA and genotype the three SNP loci to determine whether the species has high protein content. The detection method provided by this invention is fast, low-cost, and suitable for large-scale sample testing. This detection method can be applied to soybean molecular marker-assisted breeding selection, variety improvement, and germplasm resource evaluation.
Owner:BEIJING DABEINONG TECHNOLOGY GROUP CO LTD +1

Headspace-gas chromatography detection method for 1, 3-butadiene in automotive interior material

The invention discloses a headspace-gas chromatography detection method for 1, 3-butadiene in an automotive interior material, which comprises the following steps: 1) crushing a sample into fine particles, freezing with liquid nitrogen, embrittling, and crushing at low temperature; and (2) weighing a sample which is recovered to room temperature after being crushed, putting the sample into a headspace bottle, quickly sealing, and carrying out gas chromatography detection in a headspace sampling mode. On the basis of the headspace-gas chromatography technology, by optimizing headspace sampling conditions, instrument parameters and chromatographic column selection, the 1, 3-butadiene detection method which is simple and convenient in pretreatment, high in sensitivity and accurate in quantification is established. And the method is precisely positioned on a specific and complex substrate, namely an automotive interior material. Compared with the prior art, the method is simple and convenient to operate and high in detection speed, can effectively avoid the problems of incomplete dissolution, difficulty in sample introduction and the like, is suitable for measuring an actual sample, and provides a reliable technical means for detecting the residual quantity of 1, 3-butadiene in the automotive interior material.
Owner:CHERY AUTOMOBILE CO LTD

Probe targeting staphylococcus aureus and application thereof

The invention discloses a probe for targeting staphylococcus aureus and an application of the probe. The amino acid sequence of a nano antibody is as follows: QLQLVESGGLVQAGGSMRLSCAASGRTFSTNTMGWFRQAPGKEREFVAGIRWISGSTQADSVKGRFTISRDNAKNTLFLQMNSLPEDAVYYCAAGPHNIPILRTSAYNYWGQGTQVTVSS, and the amino acid sequence of the nano antibody is as follows: QLQLVEGGGLVQAGGTQVTVSS. According to the invention, a high-performance probe is screened, and a high-sensitivity electrochemical sensor is constructed to realize rapid and accurate screening of staphylococcus aureus in different media; staphylococcus aureus can be qualitatively detected within one minute, and the method has high sensitivity and excellent specificity and accuracy. The method meets the urgent demand of accurately, reliably and quickly detecting the staphylococcus aureus in a complex environment.
Owner:WEST CHINA HOSPITAL SICHUAN UNIV +1

An alzheimer's disease prediction method, system, device, and medium

This invention relates to the field of medical data processing technology, and discloses an Alzheimer's disease prediction method, system, device, and medium, comprising: obtaining spectral data of a target group in a non-invasive manner; training an Alzheimer's disease prediction model based on the spectral data; the target group includes healthy individuals and individuals with Alzheimer's disease. This invention non-invasively obtains samples from the target group, utilizing the advantages of laser-induced breakdown spectroscopy (LAS) for simultaneous detection and analysis of all elements at high speed. It achieves qualitative or quantitative analysis of the chemical composition of material surfaces by measuring the emission spectrum of micro-plasma, accurately and rapidly obtaining spectral data of the target group. The Alzheimer's disease prediction model trained based on the spectral data can effectively assist doctors in early screening of individuals, enabling early intervention for patients with early-stage Alzheimer's disease, and has broad application prospects.
Owner:INST OF MODERN PHYSICS CHINESE ACADEMY OF SCI

A method for detecting a leak in a fuel vapor system and an electronic device

The application provides a leakage detection method of a fuel evaporation system and an electronic device, and is applied to a fuel evaporation system of a vehicle. The method comprises the following steps: when the parking time of the vehicle exceeds a first preset time length, and the enabled working condition of the fuel evaporation system is normal, the vacuum degree of a first space in which a first electric control valve is in a closed state is obtained; a first diagnosis strategy or a second diagnosis strategy is selected according to the vacuum degree, and leakage detection is performed on the first space and a second space to obtain a detection result, wherein the first diagnosis strategy is a diagnosis strategy corresponding to that the first space has no leakage when the absolute value of the vacuum degree is greater than a first preset threshold. In this way, an air pump does not need to be additionally arranged, so that the hardware cost of the system is reduced. In addition, different diagnosis strategies are beneficial to improving the diagnosis completion rate. Since the first space of the fuel evaporation system rarely leaks, the frequency of using the first diagnosis strategy is usually high, and the detection process of the first diagnosis strategy is less, so that the diagnosis efficiency is improved.
Owner:CHONGQING CHANGAN AUTOMOBILE CO LTD

Construction method and application of SERS (Surface Enhanced Raman Scattering) biosensor for detecting vomitoxin

The invention provides a construction method and application of an SERS (Surface Enhanced Raman Scattering) biosensor for detecting vomitoxin. The SERS biosensor is used for rapidly detecting the vomitoxin (DON) in real time. Ag is sputtered on the surface of the filter paper through a magnetron sputtering method, so that the surface of the filter paper has a Raman signal enhancement effect. An aptamer (Apt) of vomitoxin is selected as a recognition sensing element to specifically capture DON, Apt is connected to filter paper through an Ag-S bond, Au-4-ATP-cDNA is further modified and connected to the filter paper through complementation of Apt and cDNA, and 4-ATP serves as a signal molecule to provide a Raman signal. When the DON exists, the Apt is combined with the DON and is separated from the cDNA, the Raman signal of the 4-ATP is weakened after the Au-4-ATP-cDNA falls off, and the DON is quantitatively analyzed by detecting the Raman signal change of the 4-ATP. The sensor has high sensitivity, specificity and stability, provides a new idea for on-site rapid detection and real-time monitoring, and has application value and application prospect.
Owner:NANJING NORMAL UNIVERSITY

Lane line detection method combining deep learning and image processing

The invention designs a lane line automatic detection method based on combination of a YOLO algorithm and image processing. The method comprises an image acquisition module, a lane line identification module, an area screening module and a lane line marking module. Firstly, an image of the driving condition in front of a vehicle is collected through a vehicle-mounted camera; secondly, through a target detection algorithm and an optimal model weight obtained through training of a lane line training set, calibration of a rectangular area where a lane line is roughly located is obtained; thirdly, carrying out region screening by utilizing a mask; and finally, marking the lane lines through a traditional image processing mode. According to the method, a lane line detection method combining deep learning and a traditional image processing mode is established, the calculated amount is small, the accuracy rate is high, and the method is suitable for application of a carrier in many scenes.
Owner:SUZHOU ZHIZHEN WEISHI OPTOELECTRONICS TECHNOLOGY CO LTD

Device for detecting falling resistance of instruments and meters

The utility model relates to the technical field of instrument and meter detection, and discloses an instrument and meter falling resistance detection device which comprises a base, a motor is installed on the inner wall of the bottom of the base, one end of an output shaft of the motor is connected with a screw rod through a coupler, and the outer wall of the screw rod is connected with a sliding plate through threads. A sliding groove is formed in the outer wall of the top end of the sliding plate, clamping plates are slidably connected to the inner walls of the two sides of the sliding groove, triangular blocks are fixedly connected to the outer walls of the top ends of the clamping plates, supporting plates are fixedly connected to the outer walls of the two sides of the top end of the sliding plate, and telescopic rods are fixedly connected to the outer walls of one sides of the supporting plates. When a structure clamping an instrument moves to a detection height, the pressing plate pushes the triangular blocks on the two sides, the clamped instrument directly falls off to carry out drop resistance detection, the synchronism is high, the detection speed is higher, an additional driving structure is not needed, the cost is reduced, and the detection efficiency of the drop resistance of the instrument is improved.
Owner:TANGSHAN HUITANG WULIAN TECH CO LTD

A simple pneumatic brake air tightness testing device

This invention provides a simple pneumatic brake air tightness testing device, belonging to the field of mechanical equipment. It solves the problem of time-consuming and labor-intensive air tightness testing for pneumatic brakes. The invention includes an air inlet pipe and a testing pipe. The air inlet pipe is connected to a booster pump, and a pressure gauge is installed next to the booster pump. The booster pump is connected to a ball valve, and a pressure relief valve is connected to the ball valve. A pressure gauge is connected to the pressure relief valve, and the other end of the pressure gauge is connected to the testing pipe. A pneumatic regulating valve is installed on the top of the booster valve, and a second ball valve is installed between the ball valve and the pressure relief valve. The advantages of this invention are: by connecting the testing pipe to the pneumatic brake, and then injecting compressed air into the testing pipe through the booster valve, the air tightness of the pneumatic brake can be checked; the pressure gauge can accurately indicate whether the air tightness of the pneumatic brake is qualified; the pressure regulating valve can be used to test pneumatic brakes of different specifications.
Owner:TAIZHOU HEZI ELECTRIC CO LTD

Near-infrared quantitative measurement method for PE plastic product

The invention discloses a near-infrared quantitative measurement method for a PE plastic product, and belongs to the technical field of plastic product detection. The manufacturing method comprises the following steps: determining a basic PE plastic ingredient proportion, designing a gradient standard sample formula, weighing raw materials, mixing, filling a mold, heating, fusing, curing and post-processing to obtain the standard sample. The method for establishing the measurement model comprises the following steps of: collecting a near infrared spectrum of a standard sample, preprocessing the near infrared spectrum, optimizing a characteristic wave band by adopting recursive characteristic elimination and principal component analysis, constructing a dynamic residual network model, and perfecting the model through accuracy optimization, generalization enhancement and mobility improvement strategies. According to the method, the problems that a traditional chemical analysis method is large in pollution, high in cost and poor in stability are solved, rapid nondestructive testing within 1-2 min is achieved, the correlation coefficient R2 of a model prediction value and a real value can reach 0.995, and the problem of measurement instability caused by raw material batch fluctuation is effectively solved.
Owner:SCIENCE & TECHNOLOGY RESEARCH CENTER OF CHINA CUSTOMS +1

Capacitive touch detection circuit and touch chip

ActiveCN224418789USemaphore controlcontrol chargeCapacitanceHemt circuits
The utility model relates to a kind of capacitive touch detection circuit and touch chip, involve detection technical field.The capacitive touch detection circuit includes amplification module, detection module and signal amount control module in it.The signal amount control module is provided in the detection circuit, the charge quantity in the detection circuit is changed, and due to being provided, the input value of operational amplifier can no longer be limited, so as to regulate and control the numerical value of detection signal amount, make it become larger, so that the small change of capacitor is more easily detected, greatly improve the sensitivity and accuracy of detection circuit.Moreover, its detection circuit structure is simple, and faster detection speed can be realized at low cost.
Owner:CHENGDU LIPPXIN MICROELECTRONIC CO LTD

Methods for detecting impurities E and F in lincomycin hydrochloride injection

This invention discloses a method for detecting impurities E and F in lincomycin hydrochloride injection, using liquid chromatography-mass spectrometry (LC-MS / MS). The method includes the following steps: preparing a reference solution, preparing a test solution, and LC-MS / MS detection. The LC-MS / MS detection involves injecting the reference solution and the test solution into the LC-MS / MS instrument for separation and detection. The LC parameters are as follows: separation is performed using a gradient elution method, with mobile phase A at 65%–75% and mobile phase B at 25%–35% during the 0–2 min period. This method is simple to operate, fast in detection, and has the advantages of high sensitivity, high precision, and high repeatability.
Owner:HUAXIASHENGSHENG PHARMA BEIJING CO LTD

Multi-position synchronous accuracy testing device and method for through-type current transformers

PendingCN122568402AMeet precision measurement needsImprove general performance
This invention discloses a multi-station synchronous accuracy testing device and method for through-type current transformers, relating to the field of current transformer testing technology. The scheme configures the channel mapping relationship and sampling order of the ADC sampling unit to satisfy symmetry conditions, enabling each tested through-type current transformer to obtain two symmetrical sampled values ​​or one sampled value at the same preset virtual intermediate time in a round of polling sampling. The calibrator arithmetically averages the symmetrical sampled values ​​of each tested transformer to obtain an equivalent sampled value aligned to the virtual intermediate time. Then, it calculates the ratio difference and angle difference based on the fixed delay compensation set by the system calibration. This invention eliminates the sampling time differences between channels caused by polling sampling during the sampling stage, unifying the equivalent sampling times of all channels. The compensation object converges from multiple different delays to a single system-level fixed delay, improving the accuracy of multi-station batch testing and the versatility and adaptability of the calibrator.
Owner:YANTAI DONGFANG WESTON ELECTRIC EQUIP CO LTD

Rapid RT-QuIC diagnostic kit for Parkinson's disease based on A30P mutant alpha-synuclein

PendingCN121955406ASolve the difficulty of insufficient accuracyimprove featuresMicroorganism based processesBiological testingMutated proteinBiochemistry
The invention provides a Parkinson's disease rapid RT-QuIC diagnostic kit based on A30P mutant alpha-synuclein, and belongs to the technical field of detection kits. The specific A30P mutant protein is used as a reaction substrate, and rapid and high-sensitivity amplification detection can be carried out on trace misfolded alpha-synuclein in a skin sample through an optimized RT-QuIC system. The kit has the characteristics of short detection period and convenience in operation, provides a new tool for molecular diagnosis of Parkinson's disease, is suitable for definite diagnosis of clinical PD suspected cases, and can also be used for screening high-risk groups. The kit has the advantages of mature preparation process, easily available raw materials, easiness in industrial production and large-scale popularization, and important clinical application value.
Owner:ZHEJIANG RUIGOU MEDICAL TECHNOLOGY CO LTD

A method for detecting hemoglobin

The application discloses a kind of hemoglobin detection methods, comprising: taking 0.1-0.2mmol / L (6,5)-SWCNTs solution, add to the ultrafiltration centrifuge tube with the molecular weight of 100kDa, centrifugal 1-10min, discard filtrate;In the inclusion, add the same volume of SDS solution with filtrate, repeat centrifugal 6-15 times;Again, solution ultrasonic dispersion 0.2-1h, and centrifugal 2-15min;In DPPE-mPEG5000 solution, add the supernatant above, after mixing sufficiently, stand overnight;Again, using the ultrafiltration centrifuge tube with the molecular weight of 10kDa and 100kDa respectively to the mixed solution above sequentially centrifugal filtration, take the supernatant above, add hemoglobin solution to be measured, after mixing uniformly, stand incubation 10S above;With water as blank control, carry out UV-Vis-NIR absorption spectrum and near infrared fluorescence spectrum determination;Hemoglobin standard product is prepared into different concentration stock solution, and standard curve is drawn;The concentration of hemoglobin in sample is calculated according to standard curve.The application is simple in operation, short in time, and low in detection cost.
Owner:EAST CHINA UNIV OF SCI & TECH

Kit and method for joint detection of glucose, cellobiose and xylose in cellulose hydrolysate

PendingCN122084552ARealize simultaneous quantificationincrease the amount of informationMaterial analysis by observing effect on chemical indicatorColor/spectral properties measurementsCellulosePyranose
This invention discloses a reagent kit and method for the joint detection of glucose, cellobiose, and xylose in cellulose hydrolysate, belonging to the field of biomass conversion and analytical detection technology. The method includes the following steps: setting up three types of detection channels: a glucose oxidase detection channel that specifically responds to the glucose component; a β-glucosidase-glucose oxidase combined detection channel that responds to the total signal of glucose and cellobiose; and a pyranose oxidase detection channel that simultaneously responds to the combined signals of glucose, cellobiose, and xylose. Enzymatic colorimetric reactions are performed on the cellulose hydrolysate sample and the multi-component gradient standard solution in the three types of detection channels, respectively. A ternary linear calibration model is constructed based on the absorbance data of the three types of channels of the multi-component gradient standard solution. This method provides a rapid, low-cost, and highly specific detection method for glucose, cellobiose, and xylose in cellulose biomass hydrolysate, and has practical application value.
Owner:JINING UNIV

Integrated full-scene adaptive total phosphorus rapid detection platform

ActiveCN224216714URealize full process automation operationshort analysis timeMaterial analysis by observing effect on chemical indicatorWithdrawing sample devicesPotassium persulfateFlow cell
The utility model relates to an integrated full-scene adaptive total phosphorus rapid detection platform, which comprises a raw water collection module, a sample digestion module, a sample introduction reaction module and a detection module, the raw water collection module comprises an automatic sample injector capable of automatically switching a plurality of sample tubes and / or online water samples to collect raw water; the sample digestion module comprises sulfuric acid mixed with a sample, a heating reactor, potassium persulfate mixed with a mixed solution and an ultraviolet digestion device, and the sample introduction reaction module comprises a color developing agent mixed with the sample subjected to ultraviolet digestion, ascorbic acid mixed with the mixed solution and a heating reactor. The detection module comprises a flow cell of a final reaction product and a detector, and a plurality of modules of raw water collection, sample digestion, sample introduction reaction, detection and the like are integrated into a whole, so that full-process automatic operation from raw water collection to final detection result output is realized.
Owner:ZHUHAI WATER CONTROL TESTING TECH CO LTD +1

Bush inner hole go-no detection device

The utility model discloses a bushing inner hole go-stop detection device comprising a base plate, the base plate is provided with a first limiting plate which is driven by a cylinder to move along the X-axis direction and the Z-axis direction, the upper surface of the base plate is fixedly provided with a product placing seat in the stroke of the first limiting plate, and one side of the product placing seat far away from the first limiting plate is provided with a sensor part; a third air cylinder and a displacement sensor are fixedly mounted on the side face of the lower vertical plate, a spring mounting seat is fixedly mounted on the side face of the lower vertical plate and located above the displacement sensor, a spring is arranged in the spring mounting seat, a go-no go gauge is inserted into the spring, and the part, located above the spring, of the go-no go gauge transversely penetrates through a limiting rod; the lower end of the go-no go gauge is fixedly connected with the moving part of the displacement sensor, and a lower sensor part is installed at the edge of the side face of the lower vertical plate and comprises two sensors for sensing the stroke of the second limiting plate. The device is high in automation degree in the whole process and high in detection speed, and the labor intensity of workers is greatly reduced.
Owner:上海岸估精密科技有限公司

UI focus box identification method and device, and computer device

This application provides a method, apparatus, and computer device for recognizing UI focus boxes. The recognition system acquires a focus box image and an image to be recognized, and decomposes the focus box image into four border sub-images. Then, using each border sub-image as a template, the OpenCV `matchTemplate` function is called to perform template matching on the image to be recognized, resulting in four template matching result matrices. The system uses the position of the corresponding border sub-image in each template matching result matrix within the focus box image as a reference, performs coordinate offsetting and data fusion on the four template matching result matrices, and obtains a final result matrix. The system iterates through the final result matrix and finds the first element with the maximum value. Finally, the matrix coordinates of the first element in the final result matrix are used as reference coordinates to calculate the overall coordinates of the focus box in the image to be recognized, thus achieving focus box recognition with fast detection speed and high accuracy.
Owner:GUANGZHOU SHIKUN ELECTRONICS TECH CO LTD

Real-time circuit board defect detection method and system based on improved YOLOv5 model

ActiveCN120495190BImprove context modeling capabilitiesImprove detection accuracy
This invention discloses a real-time circuit board defect detection method and system based on an improved YOLOv5 model. The method includes: acquiring a dataset; training an improved YOLOv5 model using the dataset; the improved YOLOv5 model is based on the YOLOv5 model, replacing the original backbone network with a lightweight SE-ENv2 backbone network to reduce computational complexity and retain more feature information of small-sized defects; replacing the original neck network with a GC-Neck network to improve the model's contextual modeling ability; replacing the original head network with a TECODE detection head to learn and fuse multi-scale defect features; pruning the trained YOLOv5 model; and inputting real-time acquired circuit board images into the pruned YOLOv5 model to obtain defect detection results. This invention can detect circuit board defects accurately and in real time.
Owner:SOUTH CHINA UNIV OF TECH

A honeycomb ceramic carrier internal defect automatic detection device

PendingCN122545509AIncreased detection rate of internal hidden defectsReduce false alarm rate
This invention provides an automatic defect detection device for internal defects in a honeycomb ceramic carrier, mainly comprising: a main frame; high-transparency optical glass, which is disposed on the upper surface of the main frame as a carrier support platform; a high-brightness light source, which is disposed below the high-transparency optical glass; a vision camera, which is an industrial area array camera capable of uniform, high-precision reciprocating scanning motion along the length of the carrier controlled by a servo module; a lens, which is disposed below the vision camera; a control unit configured to control the movement of the vision camera and acquire continuous transmission images of the entire length of the carrier with high overlap; and an image processing unit configured to perform defect analysis on the acquired images and output the analysis results. This device, through a special optical imaging system and image processing algorithm, achieves non-contact, high-precision, and automated detection of internal defects such as blockages and cracks in honeycomb ceramic carriers.
Owner:SHANDONG SINOCERA FUNCTIONAL MATERIAL CO LTD

A spiral optical fiber-based crude oil water cut detection method and system

ActiveCN116106234BAchieve upper and lower separationImprove detection accuracy
The application discloses a kind of based on spiral optical fiber's crude oil water content detection method and system;The method comprises: the crude oil to be detected water content is placed in a container with super-hydrophobic super-oleophobic material is sprayed on inner wall, to realize oil-water separation up and down;Wherein, the container is coiled with a section of spiral side light emitting optical fiber from bottom to top along inner wall;The container includes but is not limited to crude oil well;After realizing oil-water separation up and down, input light wave into the side light emitting optical fiber using laser light source;Using spectrometer to detect the light wave reflected or transmitted from the side light emitting optical fiber, obtain current spectral data;Based on the current spectral data, the height of liquid level and oil-water interface in the container is determined;Based on the liquid level and the height of oil-water interface, calculate the water content of crude oil.The application can improve the detection efficiency and detection accuracy of crude oil water content, and simplify the detection process and the complexity of detection equipment.
Owner:XIAN UNIV OF POSTS & TELECOMM

Piston outer diameter automatic measuring and sorting apparatus

ActiveCN121715340BMeet the needs of mass testingReduce labor intensity
This invention discloses an automatic piston outer diameter measurement and sorting device, belonging to the field of mechanical parts inspection and sorting technology. To solve certain problems, it specifically includes: a cabinet, a feeding assembly, a discharging assembly, a conveying assembly, a measuring assembly, and a control mechanism. This invention automatically picks up the piston to be inspected by the feeding assembly and sends it to the conveying assembly. The conveying assembly continuously transports the workpieces, the measuring assembly automatically completes positioning and outer diameter detection, and the discharging assembly automatically sorts and grades the parts. The entire process requires no manual intervention in feeding, positioning, discharging, and sorting operations, reducing labor intensity. Furthermore, relying on the precise transmission of the mechanical structure and the automated data acquisition of the pneumatic probe, it avoids the experience-dependent errors of manual caliper measurements, resulting in more objective and accurate measurement data. All components are centrally coordinated through the control mechanism, ensuring tight coordination between feeding, conveying, inspection, and sorting. The pre-inspection stage removes invalid workpieces in advance, reducing unnecessary measurement time and meeting the high-volume inspection needs of the production line.
Owner:BEIJING YICHIYUNZHI TECH CO LTD

Online sampling and detection device with split-flow structure

ActiveCN224744806Uavoid state differencesimprove consistency
The utility model discloses an online sampling detection device with shunt structure, which comprises a sampling flow path, a shunt structure, a detection cell, a monomer content detection module, a microfluidic pretreatment structure, an element detection module and a data processor. The sampling flow path obtains a sample to be measured from the material in a formula pool, and the shunt structure divides the sample into a first sample stream and a second sample stream. The first sample stream flows through the detection cell, and the monomer content detection module arranged on one side of the detection cell detects the monomer residual information of the first sample stream. The second sample stream passes through the microfluidic pretreatment structure to be diluted and mixed online to form a liquid to be measured, and the element detection module detects the element impurity information of the liquid to be measured. The data processor generates a quality detection result, thereby realizing a parallel double detection flow path, improving the detection speed, achieving graded reuse and batch tracing, and achieving other purposes.
Owner:ZHUHAI ENERGY NEW MATERIALS TECH CO LTD