159 results about "Breast cancer cell line" patented technology

The present invention relates to a novel gene, Di12, that is differentially expressed as a 1.35 kb RNA in breast cancer tissues and cell lines, and in several normal tissues. The full length cDNA encodes a protein of 339 amino acids. Antibodies to the gene product were developed to investigate the expression of Di12 in breast cancer cell-lines and tumors. The Di12 protein was found in tissue sections of infiltrating ductal carcinomas (IDCs), but not in benign or normal breast specimens. Di12 wag also present in IDC-breast cancer patient sera, and its expression level increased markedly if IDC was accompanied by lymph node or distal metastases. As IDC constitutes ~70% of breast cancers seen clinically, the level of Di12 expression is useful for diseases diagnosis predicting disease progression and monitoring a therapeutic treatment.

The invention relates to a polypeptide with tumor-targeting performance and a preparation method. The structure of the aminophenol sequence of the polypeptide is CASPSGALRSC or CFPVPGHDLVC or CFSVPGHDIVC or CTPMSLSLSEC or CYTYPLGWHIC. The pC89 phage peptide library expressing protein polypeptides with different sequences of 108 and human breast cancer cell lines MDA-MB-231 are repetitively cocultured for a few times; filtration can penetrate cell membrane to enter into the phages expressing specific polypeptide in cytolymph and / or karyon, and phages are amplified in vitro in order to carry out DNA sequencing and deduce an exogenous amino acid sequence inserted in the phages; the filtered specific polypeptide phages, other human tumor cells and normal cells are cocultured in vitro, and the tumor cell specificity of the polypeptide phages is tested; according to the testing results of polypeptide sequence and cell specificity, the polypeptide with tumor targeting is artifically synthesized. The invention as a specificity carrier of the mammary cancer-targeting genetic therapy has potential clinic application value. The invention also provides a strong technical support for the filtration of affinity specificity polypeptide of other types of malignant tumor cell strains. Moreover, the polypeptide only contains nine to eleven amino acid residues, so the polypeptide can be easily synthesized, the change of spacial position is relatively less, the quality control of the polypeptide is easy, and use is convenient.

The present invention relates to a pharmaceutical composition for the prevention and the treatment of cancers containing diaryl-isoxazole derivatives as an effective ingredient. Diaryl-isoxazole derivatives of the present invention inhibit metastasis of breast cancer cell lines and angiogenesis, so that they can be produced as a metastasis inhibitor and further as a pharmaceutical composition for the prevention and the treatment of angiogenesis related diseases including cancers, rheumatoid arthritis, psoriasis, or angiogenesis diseases caused in eyeball, etc.

The invention relates to a phenothiazine compound and a preparation method thereof. The invention further relates the application of the phenothiazine compound in anti-cancer drug preparation and anti-cancer drugs using the compound as the effective component. The phenothiazine compound has the advantages that the compound with broad-spectrum anti-cancer effect is obtained by modifying phenothiazine ternary interlink parent nucleuses, synthesizing method is simple, and high yield is achieved; the phenothiazine compound has certain restraining effect on human breast cancer cells line MCF-7 and human hepatoma cell line Hep-G2, and a new thought is provided to new drugs satisfying clinic requirements.

The invention discloses a resveratrol benzene acrylamide derivative, a preparing method and an application thereof. The resveratrol benzene acrylamide derivative has a structure shown in general formula (1) and general formula (2): the resveratrol benzene acrylamide derivative has an obvious effect of growth inhibition for a human body breast cancer cell line (MCF-7), a human body lung cancer cell line (A549) and a human body melanoma cell line (B16-F10), thereby the resveratrol benzene acrylamide derivative can be used for preparing antineoplastic drugs.

The present invention discloses a cyclic pentapeptide with anti-tumour activity, which is cyclic (leucyl-N-methylleucyl-leucyl-leucyl-N-methylleucyl) and the constitutional formula of which is shown in the formula (I). The cyclic pentapeptide of the present invention is separated from galaxaura filamentosa in the South China Sea, and in vitro experiments show that the cyclic pentapeptide has strong inhibiting effect on human hepatoma cell lines (HepG2), human hepatoma cell lines (BEL-7402), human mammary cancer cell lines (MCF-7), human colon cancer cell lines (LOVO), human lung cancer cell lines (PC84045) and human nasopharyngeal cancer (CNE) and can keep the mitotic cycle of BEL-7402 hepatoma cells in G2 / M phase. The present invention provides a pilot compound for the research and the development of new anti-tumour drugs and is valuable for the exploitation of the marine pharmaceutical resources of China.

The invention discloses dehydroabietic acid benzimidazole derivatives with antitumor activity as well as a preparation method and an application of the dehydroabietic acid benzimidazole derivatives. The dehydroabietic acid benzimidazole derivatives I-a to I-l with the structures shown in a general formula I and pharmaceutically acceptable salt of the derivatives are shown in the description, wherein corresponding Aryl of dehydroabietic acid benzimidazole derivatives I-a to I-l are shown in the description respectively. Nitrogen-containing heterocyclic compounds are pharmaceutically acceptable salt of the dehydroabietic acid benzimidazole derivatives and have good antitumor bioactivity. Pharmacology experiments prove that the compounds have a remarkable inhibition effect on hepatoma cell lines SMMC-7721, breast cancer cell lines MDA-MB-231 and colon cancer cell lines CT26.

The invention discloses a quality control sample for detecting breast cancer and a preparation method of the quality control sample, particularly relates to a quality control material for HER2 gene amplification FISH detection and a preparation method of the quality control material, and belongs to the technical fields of clinical laboratory medicine, pathology and biotechnology. The quality control sample for detecting the breast cancer is a paraffin-embedded specimen slice prepared by a cultivated breast cancer cell line. The quality control sample has the advantages that the quality control sample prepared by the breast cancer cell line cultured in vitro can be used as substitute goods of the quality control sample for fabricating real tissue samples, and is high in sample capacity and high in repeatability; and detection of different HER2 gene levels can be finished by selecting difference cell lines. The quality control sample is simple and convenient in preparation method, and easy to store, can be put into volume production, and can be applied to internal quality control and external quality assessment.

The invention discloses a quinoline derivative as shown in the formula (I) in the specification and a salt of the quinoline derivative, wherein in the formula, Z is NH or O; R is selected from hydrogen, fluorine, chlorine, bromine, methyl, ethyl, tertiary butyl, trifluoromethyl, methoxyl or nitryl; n is an integer of 0, 1, 2 or 3. The invention relates to a preparation method and application of the compound as shown in the formula (I) in the specification and the salt of the compound. The compound or the salt has very high inhibition activity for a human lung cancer cell strain A549, a colorectal cancer cell strain HCT-116 and a breast cancer cell strain MCF-7. The compound has a broad-spectrum anti-cancer activity and can be used as a candidate medicine or a lead compound for treating diseases such as tumor and cancer.

The invention belongs to the field of medical biology, and specifically provides a designing and preparing method of a class of effective signal transduction inhibition compounds for signal transducerand activator of transcription type3 (STAT3), and applications of the effective signal transduction inhibition compounds mainly in clinical treatment of breast cancer. According to the present invention, a variety of breast cancer cell lines have the abnormal intracellular STAT3 signaling system regulation mechanisms, and the compounds of the present invention can significantly inhibit the signaltransduction of STAT3 so as to provide the potential important significance in the clinical treatment and research of breast cancer.

The invention discloses siRNA (small interfering ribonucleic acid) for specifically inhibiting human ER81 gene expression, and a preparation method and screening method of siRNA. An ER81 gene is used as a target point sequence, and aiming at the homologous sequence of seven transcription mutant coding regions of the gene, an interference target point is selected from each of the upstream side, the midstream side and the downstream side so as to construct three recombinant siRNA expression vectors. The siRNA recombinant expression vectors is transferred into a breast cancer cell line MDA-MB-231 and an siRNA segment which can be used for obviously inhibiting the ER81 gene expression is finally screened out by using a DNA (deoxyribonucleic acid)-mediated RNA interfering technology. Experimental results show that screened siRNA can be used for specifically and efficiently inhibiting the ER81 gene expression so as to inhibit the proliferation of the breast cancer cells and promote cell apoptosis. Screened siRNA disclosed by the invention provides a new way for preparing related medicaments for treating breast cancers and shows good application prospects.

This invention relates to the preparation of wheat germ agglutinin (WGA) and its application in restraining breast cancer's activity. It belongs to a field of wheat by-product material's deep processing technology. The wheat germ was comminuted, degreased,deep comminuted, super sound intensified acid extracted, salting out, heat treated, ultrafiltrated and affinity chromatographed, then the composition which have red cell agglutinating activity was desalted and freeze dried, and at last WGA is gained. Cell culture determines that the WGA has depressant effect on rat breast cancer cell strain SHZ and trypsin dependent form human breast cancer cell strain MCF-7. This invention's technology design is scientific and reasonable, manipulate is convenient and procedure is not polluted. The invention provides groundwork for exploiting drug of restraining cancer, and can enhance the utilization value of wheat germ deep processing and related industry's economic returns.

The invention discloses an application of SNHG5 (small nucleolar RNA host gene 5) in diagnosis, evaluation and efficacy prediction of breast cancer. It is found that lncRNA SNHG5 has significant low expression in breast cancer tissue and breast cancer cell lines, knockout of the lncRNA SNHG5 gene can enhance proliferation and migration of breast cancer cells and inhibit apoptosis, and thus, the expression level of long-chain non-coding RNA SNHG5 is closely related with diagnosis, transfer and relapse of tumor, patient prognosis and neoadjuvant chemotherapy effect are closely related, which indicates that the lncRNA SNHG5 gene can be used as a marker for diagnosis, prognosis evaluation or effect prediction. A breast cancer cell model which has low expression of SNHG5 and is established by transfecting breast cancer cell lines with small interference RNA can be used in a preparation method of a preparation for preventing relapse and transfer of breast cancer.

The invention discloses a biphenyl compound serving as an antitumor medicament and a preparation method thereof. The biphenyl compound has antitumor activities in vitro and in vivo, has the effects of inducing apoptosis and inhibiting proliferation on colorectal cancer cell lines, lung cancer cell lines, liver cancer cell lines, breast cancer cell lines or pancreatic cancer cell lines in vitro and has the effects of inhibiting tumors on liver cancers and colorectal cancers in vivo. The biphenyl compound can be applied to preparation of the antitumor medicament. The preparation method of the biphenyl compound has the advantages of readily available raw materials, mild reaction conditions, easily operated reaction processes and cheap and readily available reagents.

A cell line of high-transfer human breast cancer is prepared from the human breast cancer cell strain MDA-MB-435 as the source cell through continuous screening in the body of naked mouse, and has high idiopathic transfer phynotype. Said cell belongs to triploid caryotype, and has 50-52 chromosomes, high percentage of S-phase cells increased by 15%, high infiltrating and transfer power increased by 2 times, and high tumor forming ratio in naked mouse.

The invention discloses a compound Chinese actinidia root Chinese medicinal composition and a preparation method and application thereof, belonging to the technical field of traditional Chinese medicines. The Chinese medicinal composition is characterized by comprising the following traditional Chinese medicines in parts by weight: 40-80 parts of Chinese actinidia root, 20-40 parts of salvia chinensis, 20-40 parts of herba scutellariae barbatae, 20-40 parts of herba oldenlandiae and 20-40 parts of giant knotweed. The compound Chinese actinidia root Chinese medicinal composition has remarkable proliferation inhibition effects on various cancer cells such as a hepatoma cell line Hep-G2, a lung cancer cell line NCI-H460, a gastric cancer cell line MGC-803, a breast cancer cell line MCF-7, a colon cancer cell line HCT-116 and the like, and can be used for reducing physical and psychological pains of a cancer patient in the chemo-treatment process and solving the problems of difficult and expensive administration.

HA-based functional probes and a multiplexed targeting strategy for detection and isolation of invasive subpopulations in breast cancer cell lines. Methods for using HA metabolism for profiling and sorting breast cancer heterogeneity. As such, HA-based functional probes have appropriate targeting capacity and safety profiles for development as imaging and therapeutic agents for following repair and neoplastic disease processes such as breast cancer.

The invention relates to the use of an antibody or a fragment thereof, specific against substance P, for the manufacture of a medicament for therapeutic treatment of a cancer expressing NK1 receptor and / or a ErbB receptor family member (i.e. the epidermal growth factor receptors family), by direct administration to a mammal, including a human. The administration of an antibody against substance P to a panel of breast cancer cell lines, inhibits HER2 activation and expression, causing a downregulation of different genes involved in cell cycle progression, like cyclin D1, cyclin E, cdk4 and cdk2. A decrease in proliferation and an arrest in G1 phase of cell cycle are observed. On the other hand, the antibody causes an induction of apoptosis.

The invention discloses a preparing method of monoclonal antibody (hMIF) to against human macrophage transferring inhibitor and getting method of amino acid sequence in biological medicine engineering technical domain, which comprises the following steps: augmenting out of hMIF gene from human breast cancer cell strain MDA-MB453 and human breast cancer tissue through reverse transcript polyose chain type reaction; constructing pET-11b / hMIF restructuring plasmid; expressing and purifying on bacillus coli BL21(DE3); immunizing Balb / c mouse; getting splenocyte of mouse and anti-hMIF monoclonal antibody 2D10 merged with SP2 / 0 cell through hybridomas technology; proceeding antibody subclass appraise and specificity test of antibody; making the secreting monoclonal antibody from 2D10 belong to IgG; setting the light chain as K type; setting the amino acid sequence of variable area of light chain as CRASGRNNAWYKGADGWYKGKAKRYAASSSGVSRSGSG SGTTTSSDATYYCHNDAVYSYGTKVKR; making the amino acid sequence of variable area as VWSGGSTVKG GRSCGYYASGTSTYSMGMNWVRAGKGWVSSSTSVDTYYYADSVKGRTSRDNAKNSYDY DVSRADTAVYYCARDGASSGWGVDATGSRVSCYWGGTVSSWMSAT. This anti-hMIF monoclonal antibody provides effective criterion for further transformation of human source, which can lay the groundwork for treating whole body inflammation in clinical therapeutics.

The invention discloses preparation methods of a gene nanometer vector (4'-methyl-2,2'-bipyridine-4-amide-RGDDF)bis(2,2'-bipyridine)ruthenium dichloride(Ru-CO-RGDF) and a Ru-CO-RGDF / survivin-siRNA gene delivery system, wherein a concentration ratio of a gene nanometer vector Ru-CO-RGDF to protamine in the Ru-CO-RGDF / survivin-siRNA gene delivery system is 1:8 ,the concentration of Ru-CO-RGDF is 0.21875 [mu]g / [mu]L, a ratio of surviving-siRNA to a DNA complex is 2:1, and the Ru-CO-RGDF / survivin-siRNA gene delivery system has effects of slow release and targeting. According to the present invention, the antitumor activity of the complex and the gene silencing efficiencies at the mRNA level and the protein level are evaluated by using the breast cancer cell line MCF-7 as the model, wherein the results show that the Ru-CO-RGDF / surviving-siRNA gene delivery system has excellent antitumor activity and excellent gene silencing efficiency compared to various control groups; and by using the mice bearing S180 ascitic tumor as the model to evaluate the antitumor activity of the Ru-CO-RGDF / surviving-siRNA gene delivery system, the results show that the Ru-CO-RGDF / surviving-siRNA group has the antitumor effect.

The invention discloses a tetracyclic diterpenoid compound and a preparation method as well as application thereof. The tetracyclic diterpenoid compound is obtained through extractum extracting, organic solvent leaching, column chromatography on silica gel and high pressure liquid chromatography separation by taking Araliadumetorum Hand.-Mazz roots as a material. The compound has a molecular formula of C20H30O3, is named as dumetorumane B, and has the following structural formula as shown in the description. The preparation method means that the tetranuclear diterpenoid is obtained through extractum extracting, organic solvent leaching, column chromatography on silica gel and high pressure liquid chromatography separation by taking the Araliadumetorum Hand.-Mazz roots as the material. The application is application of the tetranuclear diterpenoid to preparation of drugs for preventing and / or treating tumour and to preparation of drugs for preventing and / or treating human lung adenocarcinoma, human acute promyelocytic leukemia or human breast cancer. The tetranuclear diterpenoid has a remarkable inhibiting effect on cell strains of human lung adenocarcinoma, human acute promyelocytic leukemia or human breast cancer, has good antitumor activity indicatively, and can serve as an antitumor activity component or a lead compound.

The invention relates to a ferrocene derivative shown as a formula (IA) or a formula (IB) or a pharmaceutically-acceptable salt or a solvate and a medicinal composition thereof. In the formula, R is independently selected from hydrogen, halogen, a cyano-group, a nitro-group, alkyl with 1 to 6 carbon atoms, alkoxy with 1 to 6 carbon atoms, hydroxyl-alkyl with 1 to 6 carbon atoms, halogenated alkyl with 1 to 6 carbon atoms, halogenated alkoxy with 1 to 6 carbon atoms, or alkoxy with 1 to 6 carbon atoms; Z is selected from O, S or NR1; R1 is hydrogen or alkyl with 1 to 6 carbon atoms independently; n is an integer of 0 to 5. The invention further provides a preparation method and medical application of the compound shown as the formula (IA) or the formula (IB) or the pharmaceutically-acceptable salt thereof. The compound has very high restraining activity specific to a lung cancer cell line A549, a colorectal carcinoma cell line HCT116 and / or a breast cancer cell line MCT-7, has broad-spectrum anti-cancer activity, and can be taken as a candidate compound or a lead compound for treating tumor diseases or cancer diseases. The derivative is shown in the description.

The truncated ErbB2 receptor (p95ErbB2) is shown to differ from the full-length ErbB2 receptor in its association with other ErbB receptors. The truncated receptor preferentially associated with ErbB3, whereas full length ErbB2 heterodimerizes with either EGFR or ErbB3. Consistent with p95ErbB2 heterodimerization with ErbB3, it is shown that heregulin (an ErbB3 ligand) stimulates p95ErbB2 phosphorylation in breast cancer cell lines. Described herein are methods of identifying patients suitable for treatment with a p95ErbB2 inhibitor, and methods of treating such patients.

The present invention provides a probe and the application thereof. The probe comprises a spacer arm, and bait protein, a photoreactive group and an enriched group attached to the spacer arm. The baitprotein comprises a protein structure domain for identifying specific protein after translational modification, such as an SH2 domain for identifying tyrosine phosphorylation. According to the probeprovided by the present invention, the activity of the target protein cannot be affected by the probe, when the bait protein interacts with the target protein, ultraviolet radiation promotes covalentbinding of the photoreactive group and the target protein, and protein complexes are effectively enriched and obtained through the enriched group, so that analysis on weak interactions and transient interactions between proteins can be facilitated, enrichment and identification abilities of target proteins and complexes thereof in the human or animal tissue samples and near the cell membranes aresignificantly improved, enrichment and identification of tyrosine phosphorylation protein complexes in different breast cancer cell lines and breast cancer tissues are successfully realized, and the probe has broad application prospects and market value.

The invention relates to a preparation method and application of an anticancer compound. The preparation method comprises the following steps of: heating dry serrate rabdosia herb leaves and ethanol in an amount which is 2 to 4 times weight of the dry serrate rabdosia herb leaves until boiling, performing refluxing extraction, filtering to obtain supernate, concentrating under reduced pressure to make the concentrated supernate 50 to 70 percent of the original supernate to obtain a concentrated solution, and freeze-drying to obtain powder; dissolving the power in water, loading on a D101 macroporous resin column, eluting by using an ethanol solution, collecting eluant, freeze-drying to obtain powder A; dissolving the powder A in water, loading on an HP-20 macroporous resin column, eluting by using a 70 to 90 percent ethanol solution, collecting eluant, and freeze-drying to obtain powder B; and dissolving the sample B in methanol to ensure that the concentration is 5-50mg / ml, performing gradient elution by using a reversed phase C18 column, collecting a compound peak eluted by 40 percent of water and 60 percent of methanol. The compound is applied to preparation of antitumor medicines, and has toxicity for human liver cancer cell lines, human leukemia cell lines and human breast cancer cell lines.

Breast cancer cell lines selected from the group consisting of ZR-75-1 and SK-BR-3 are treated by a method comprising: identifying the presence of at least one of breast cancer cell lines ZR-75-1 and SK-BR-3 in a patient; and providing a solution of boric acid or boric acid salts to the patient in a manner that delivers boric acid or boric acid salt to breast cancer cells in the patient.

The present invention relates to the ferrocene derivative represented by formula (IA) or formula (IB), or to the pharmaceutically acceptable salt or solvate thereof and to the pharmaceutical composition thereof. Wherein, R is independently selected from H, halogen, cyano, nitro, C1-C6 alkyl, C1-C6 alkoxy, hydroxy-C1-C6 alkyl, halo-C1-C6 alkyl, halo-C1-C6 alkoxy or C1-C6 alkoxy-C1-C6 alkoxy; Z is selected from O, S or NR1, wherein R1 is independently H or C1-C6 alkyl; n is an integer from 0 to 5. The present invention also provides a method and the pharmaceutical application thereof for preparing the compounds represented by formula (IA) or formula (IB) or the pharmaceutically acceptable salts thereof. The compounds have a strong inhibitory activity against human lung cancer cell line A549, colorectal cancer cell line HCT116 and / or breast cancer cell line MCF-7.